AibGenesis™ Mouse Anti-WASHC3 Antibody (MO-AB-14749W)


Cat: MO-AB-14749W

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-14749W Monoclonal Chimpanzee (Pan troglodytes), Cattle (Bos taurus), Marmoset, Rat (Rattus norvegicus) WB, ELISA MO14749W 100 µg
MO-AB-22860R Monoclonal Cattle (Bos taurus) WB, ELISA MO22860R 100 µg
MO-AB-30011H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO30011C 100 µg
MO-AB-67778W Monoclonal Marmoset WB, ELISA MO67778W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityChimpanzee (Pan troglodytes), Cattle (Bos taurus), Marmoset, Rat (Rattus norvegicus)
CloneMO14749W
SpecificityThis antibody binds to Chimpanzee WASHC3.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Chimpanzee WASHC3 Antibody is a mouse antibody against WASHC3. It can be used for WASHC3 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCoiled-coil domain containing 53; CCDC53
UniProt IDH2Q6Q6
Protein RefseqThe length of the protein is 194 amino acids long.
The sequence is show below: MDEDGLPLMGSGIDLTKVPAIQQKRTVAFLNQFVVHTVQFLNRFSTVCEEKLADLSLRIQQIETTLNILDAKLSSIPGLDDVTVEVSPLNVTSVTNGAHPEATSEQPQQNSTQDSGLQESEVSAENILTVAKDPRYARYLKMVQVGVPVMAIRNKMISEGLDPDLLERPDAPVPDGEIEKTVEESSDSESSFSD.
For Research Use Only | Not For Clinical Use.
Online Inquiry