AibGenesis™ Mouse Anti-wdr83os Antibody (MO-AB-09129H)


Cat: MO-AB-09129H

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-09129H Monoclonal Frog (Xenopus laevis), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, Pig (Sus scrofa), Rat (Rattus norvegicus) WB, ELISA MO09129C 100 µg
MO-AB-22954R Monoclonal Cattle (Bos taurus) WB, ELISA MO22954R 100 µg
MO-AB-24886W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO24886W 100 µg
MO-AB-30021H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO30021C 100 µg
MO-AB-31240R Monoclonal Pig (Sus scrofa) WB, ELISA MO31240R 100 µg
MO-AB-67866W Monoclonal Marmoset WB, ELISA MO67866W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityFrog (Xenopus laevis), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, Pig (Sus scrofa), Rat (Rattus norvegicus)
CloneMO09129C
SpecificityThis antibody binds to Frog wdr83os.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewThis product is a mouse antibody against wdr83os. It can be used for wdr83os detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesMGC81480 protein; wdr83os; MGC81480
UniProt IDQ6NTW8
Protein RefseqThe length of the protein is 106 amino acids long.
The sequence is show below: MTGNGANDPRRPGKIHRYKAPTTESSPTQDDPTPDYMNLLGMIFSMCGLMLKLKWCAWIAVYCSFISFANSRSSEDTKQMMSSFMLSISAVVMSYLQNPQPMSPPW.
For Research Use Only | Not For Clinical Use.
Online Inquiry