AibGenesis™ Mouse Anti-WDR88 Antibody (CBMOAB-62342FYA)


Cat: CBMOAB-62342FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-62342FYA Monoclonal Rhesus (Macaca mulatta), Chimpanzee (Pan troglodytes) WB, ELISA MO62342FYA 100 µg
MO-AB-13733W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO13733W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Chimpanzee (Pan troglodytes)
CloneMO62342FYA
SpecificityThis antibody binds to Rhesus WDR88.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus WDR88 Antibody is a mouse antibody against WDR88. It can be used for WDR88 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesWDR88
UniProt IDF6WMU4
Protein RefseqThe length of the protein is 369 amino acids long.
The sequence is show below: QIPFKILSGHEHAVSTCHFCVDDTKLLSGSHDCTVKLWDAVDGSVVRNFEHRPKAPVVECSITADSSRVIAASYDKTVRAWDLETGKLLVRMPAHTFLVSAKFSLYSLLIVKTFIIDMALCHIHCPTASLVASNSPHHHTRTITSCCFDPDSQRVASVSLDRCIKIWDVTSQATLLTITKEAHKNELSHFGDTTLSFKKILGRVHTVVFSEMAFCEKWDLCEMRVHRDTSGLVNGGSDRKPPRLASSREYRNLLFLQGHNDWVMDVAISNNKKWILSASKDRTMRLWNIEEIDEIPLVIKYKKAMGLKVKQCERCDRPFSIFKSDTSSEVFTQCVFCRIDTRGLPAETSSSSSSERENLPPPPGGSKDD.
For Research Use Only | Not For Clinical Use.
Online Inquiry