AibGenesis™ Mouse Anti-WFDC12 Antibody (CBMOAB-62356FYA)


Cat: CBMOAB-62356FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-62356FYA Monoclonal Rhesus (Macaca mulatta), Rat (Rattus norvegicus) WB, ELISA MO62356FYA 100 µg
Inquiry
MO-AB-30027H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO30027C 100 µg
Inquiry

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Rat (Rattus norvegicus)
CloneMO62356FYA
SpecificityThis antibody binds to Rhesus WFDC12.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a member of the WAP-type four-disulfide core (WFDC) domain family. The WFDC domain, or WAP signature motif, contains eight cysteines forming four disulfide bonds at the core of the protein, and functions as a protease inhibitor. Most WFDC gene members are localized to chromosome 20q12-q13 in two clusters: centromeric and telomeric. This gene belongs to the centromeric cluster. (From NCBI)
Product OverviewMouse Anti-Rhesus WFDC12 Antibody is a mouse antibody against WFDC12. It can be used for WFDC12 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesWAP four-disulfide core domain protein 12; WFDC12
UniProt IDG1K377
Protein RefseqThe length of the protein is 112 amino acids long.
The sequence is show below: MGSSSFLVLMVSLALVTLVAAEGVKGAGIEKAGVCPADNIRCFKSDPPQCHTDQDCLGERKCCYLHCGFKCVIPVKKLEEGGNKDEDVSGPCPEPGWEAKSPGSSSTGCPQK.
For Research Use Only | Not For Clinical Use.
Online Inquiry