AibGenesis™ Mouse Anti-WFDC3 Antibody (CBMOAB-62361FYA)
Cat: CBMOAB-62361FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| CBMOAB-62361FYA | Monoclonal | Rhesus (Macaca mulatta), Cattle (Bos taurus), Marmoset, Pig (Sus scrofa), Rat (Rattus norvegicus) | WB, ELISA | MO62361FYA | 100 µg | ||
| MO-AB-22967R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO22967R | 100 µg | ||
| MO-AB-30037H | Monoclonal | Rat (Rattus norvegicus) | WB, ELISA | MO30037C | 100 µg | ||
| MO-AB-31243R | Monoclonal | Pig (Sus scrofa) | WB, ELISA | MO31243R | 100 µg | ||
| MO-AB-67881W | Monoclonal | Marmoset | WB, ELISA | MO67881W | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Rhesus (Macaca mulatta), Cattle (Bos taurus), Marmoset, Pig (Sus scrofa), Rat (Rattus norvegicus) |
| Clone | MO62361FYA |
| Specificity | This antibody binds to Rhesus WFDC3. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
| Cellular Localization | Extracellular region or secreted |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | This gene encodes a member of the WAP-type four-disulfide core (WFDC) domain family. The WFDC domain, or WAP signature motif, contains eight cysteines forming four disulfide bonds at the core of the protein, and functions as a protease inhibitor. The encoded protein contains four WFDC domains. Most WFDC genes are localized to chromosome 20q12-q13 in two clusters: centromeric and telomeric. This gene belongs to the telomeric cluster. Alternatively spliced transcript variants have been observed but their full-length nature has not been determined. (From NCBI) |
| Product Overview | Mouse Anti-Rhesus WFDC3 Antibody is a mouse antibody against WFDC3. It can be used for WFDC3 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | WAP four-disulfide core domain protein 3; WFDC3 |
| UniProt ID | H9F5L5 |
| Protein Refseq | The length of the protein is 72 amino acids long. The sequence is show below: GDIEGGQGGDCPKVLVGLCIVGCVMDENCQAGEKCCKSGCGRFCVPPVLPRKLTVNPNWTVRSDSELEIPVP. |
For Research Use Only | Not For Clinical Use.
Online Inquiry