Mouse Anti-WNT8A Antibody (MO-AB-22989R)


Cat: MO-AB-22989R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-22989R Monoclonal Cattle (Bos taurus), Cat (Felis catus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Elephant (Loxodonta africana), Ferret (Mustela Putorius Furo), Guinea pig (Cavia porcellus), Marmoset, Pig (Sus scrofa), Sheep (Ovis aries), Zebrafish (Danio rerio) WB, ELISA MO22989R 100 µg
CBMOAB-16338FYB Monoclonal Zebrafish (Danio rerio) WB, ELISA MO16338FYB 100 µg
MO-AB-08430W Monoclonal Cat (Felis catus) WB, ELISA MO08430W 100 µg
MO-AB-18040W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO18040W 100 µg
MO-AB-34072W Monoclonal Dog (Canis lupus familiaris) WB, ELISA MO34072W 100 µg
MO-AB-35993W Monoclonal Ferret (Mustela Putorius Furo) WB, ELISA MO35993W 100 µg
MO-AB-42857W Monoclonal Guinea pig (Cavia porcellus) WB, ELISA MO42857W 100 µg
MO-AB-67923W Monoclonal Marmoset WB, ELISA MO67923W 100 µg
MO-AB-31263R Monoclonal Pig (Sus scrofa) WB, ELISA MO31263R 100 µg
MO-AB-01691L Monoclonal Elephant (Loxodonta africana) WB, ELISA MO01691L 100 µg
MO-AB-18268Y Monoclonal Sheep (Ovis aries) WB, ELISA MO18268Y 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCattle (Bos taurus), Cat (Felis catus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Elephant (Loxodonta africana), Ferret (Mustela Putorius Furo), Guinea pig (Cavia porcellus), Marmoset, Pig (Sus scrofa), Sheep (Ovis aries), Zebrafish (Danio rerio)
CloneMO22989R
SpecificityThis antibody binds to Cattle WNT8A.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationExtracellular region or secreted

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe WNT gene family consists of structurally related genes which encode secreted signaling proteins. These proteins have been implicated in oncogenesis and in several developmental processes, including regulation of cell fate and patterning during embryogenesis. This gene is a member of the WNT gene family, and may be implicated in development of early embryos as well as germ cell tumors. Multiple alternatively spliced transcript variants have been found for this gene.
Product OverviewThis product is a mouse antibody against WNT8A. It can be used for WNT8A detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesProtein Wnt; WNT8A
UniProt IDE1BKL2
Protein RefseqThe length of the protein is 351 amino acids long.
The sequence is show below: MGDLLILRVAVGICYVTFSASAWSVNNFLITGPKAYLTYTTSVALGAQSGIEECKFQFAWERWNCPENALQLSTHNRLRSATRETSFIHAISSAGVMYTITKNCSMGDFENCGCDESKNGKTGGHGWIWGGCSDNVEFGERISKLFVDSLEKGKDARALMNLHNNRAGRLAVRATMKRTCKCHGISGSCSIQTCWLQLANFRELGNYLKAKYERALKIEMDKQQLRAGNSAEGHWIPTEAFLPSAEAELIFLEES.
For Research Use Only | Not For Clinical Use.
Online Inquiry