AibGenesis™ Mouse Anti-WRKY70 Antibody (CBMOAB-46126FYC)
Cat: CBMOAB-46126FYC
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
- Reference
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | A. thaliana (Arabidopsis thaliana), Arabidopsis (Arabidopsis lyrata) |
| Clone | MO46126FC |
| Specificity | This antibody binds to Arabidopsis WRKY70. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
| Cellular Localization | Nucleus |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | Transcription factor involved in senescence, biotic and abiotic stress responses by modulating various phytohormones signaling pathways (PubMed:14742872, PubMed:16623907, PubMed:17310369, PubMed:28576847). Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element. Binds to the 5'-[CT]GACTTTT-3' motif in promoters of target genes to induce their expression (PubMed:24104863). Plays an important but not indispensable role in jasmonate and salicylic acid signaling (PubMed:18713432). Regulates positively the salicylic acid (SA)-mediated signal pathway, but negatively the jasmonic acid (JA)-mediated signal pathway, thus determining the balance between these mutually antagonistic pathways (PubMed:14742872, PubMed:16623907, PubMed:18713432, PubMed:28837631). Together with WRKY46, WRKY53 and WRKY54, prevents defense response to the necrotrophic pathogens P.carotovorum and B.cinerea, but promotes defense responses (including SA-induced pathogenesis-related (PR) genes expression) against biotrophic/hemibiotrophic SA-monitored pathogens (e.g. P.syringae, E.carotovora subsp. carotovora SCC3193 and E.cichoracearum), probably by regulating negatively the JA/ET and positively the SA signaling pathways (PubMed:28837631, PubMed:16623907, PubMed:22325892). Contributes to the suppression of jasmonic acid (MeJA)-induced expression of JA-responsive genes (e.g. PDF1.2) (PubMed:22325892, PubMed:16623907). Promotes susceptibility to JA-monitored pathogens (e.g. A.brassicicola), probably by facilitating SA-controlled suppression of JA-mediated defense. Represses the biosynthesis of the phytoalexin camalexin and indol-3-ylmethyl glucosinolate (IGS) (PubMed:16623907). Represses both SA and JA/ethylene (ET) mediated defense marker genes expression (PubMed:17310369). Negative regulator of SA biosynthesis (PubMed:28837631). Negative regulator of EDS1-dependent defense against E.amylovora (PubMed:22316300). Required for RPP4-mediated disease resistance and basal defense against H.parasitica, probably via late up-regulation (LURP) of resistance genes (e.g. CML10/CaBP22 and LURP1) (PubMed:17313163). Probably involved in defense responses toward insects (e.g. P.xylostella and B.brassicae) (PubMed:25339349). Together with WRKY54, negative regulator of developmental senescence, probably via the regulation of several senescence-associated markers genes (PubMed:17310369, PubMed:22268143). Together with WRKY46 and WRKY54, promotes brassinosteroid (BR)-regulated plant growth but prevent drought response by modulating gene expression (PubMed:28576847). In collaboration with WRKY54, prevents stomatal closure and, consequently, osmotic stress tolerance (PubMed:23815736). Regulates rhizobacterium B.cereus AR156-induced systemic resistance (ISR) to P.syringae pv. tomato DC3000 (PubMed:26433201). (From uniprot, under CC BY 4.0) |
| Product Overview | Mouse Anti-Arabidopsis WRKY70 Antibody is a mouse antibody against WRKY70. It can be used for WRKY70 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | Probable WRKY transcription factor 70; WRKY DNA-binding protein 70; WRKY70; At3g56400 |
| UniProt ID | Q9LY00 |
| Protein Refseq | The length of the protein is 294 amino acids long. The sequence is show below: MDTNKAKKLKVMNQLVEGHDLTTQLQQLLSQPGSGLEDLVAKILVCFNNTISVLDTFEPISSSSSLAAVEGSQNASCDNDGKFEDSGDSRKRLGPVKGKRGCYKRKKRSETCTIESTILEDAFSWRKYGQKEILNAKFPRSYFRCTHKYTQGCKATKQVQKVELEPKMFSITYIGNHTCNTNAETPKSKTCDHHDEIFMDSEDHKSPSLSTSMKEEDNPHRHHGSSTENDLSLVWPEMVFEEDYHHQASYVNGKTSTSIDVLGSQDLMVFGGGGDFEFSENEHFSIFSSCSNLS. |
Reference
| Reference | Hussain, R. M., Sheikh, A. H., Haider, I., Quareshy, M., & Linthorst, H. J. (2018). Arabidopsis WRKY50 and TGA transcription factors synergistically activate expression of PR1. Frontiers in plant science, 9, 930. |
For Research Use Only | Not For Clinical Use.
Online Inquiry