AibGenesis™ Mouse Anti-MRPS12 Antibody (CBMOAB-02426CR)
Cat: CBMOAB-02426CR
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| CBMOAB-02426CR | Monoclonal | Yeast, C. elegans (Caenorhabditis elegans), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Rat (Rattus norvegicus) | WB, ELISA | MO02426CR | 100 µg | ||
| CBMOAB-06841HCB | Monoclonal | C. elegans (Caenorhabditis elegans) | WB, ELISA | MO06841HB | 100 µg | ||
| MO-AB-05316H | Monoclonal | Frog (Xenopus laevis) | WB, ELISA | MO05316C | 100 µg | ||
| MO-AB-16042R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO16042R | 100 µg | ||
| MO-AB-25066W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO25066W | 100 µg | ||
| MO-AB-27226H | Monoclonal | Rat (Rattus norvegicus) | WB, ELISA | MO27226C | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Yeast, C. elegans (Caenorhabditis elegans), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Rat (Rattus norvegicus) |
| Clone | MO02426CR |
| Specificity | This antibody binds to Yeast MRPS12. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
| Cellular Localization | Mitochondrion; Other locations |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 28S subunit protein that belongs to the ribosomal protein S12P family. The encoded protein is a key component of the ribosomal small subunit and controls the decoding fidelity and susceptibility to aminoglycoside antibiotics. The gene for mitochondrial seryl-tRNA synthetase is located upstream and adjacent to this gene, and both genes are possible candidates for the autosomal dominant deafness gene (DFNA4). Splice variants that differ in the 5' UTR have been found for this gene; all three variants encode the same protein. (From NCBI) |
| Product Overview | Mouse Anti-Yeast MRPS12 Antibody is a mouse antibody against MRPS12. It can be used for MRPS12 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | 37S ribosomal protein S12, mitochondrial; MRPS12; YNR036C |
| UniProt ID | P53732 |
| Protein Refseq | The length of the protein is 153 amino acids long. The sequence is show below: MLSRFMSNTWCTPLRQAQRLFSSTTTMQATLNQIKRGSGPPRRKKISTAPQLDQCPQRKGVVLRVMVLKPKKPNSAQRKACRVRLTNGNVVSAYIPGEGHDAQEHSIVYVRGGRCQDLPGVKYHVIRGAGDLSGVVNRISSRSKYGAKKPSKS. |
For Research Use Only | Not For Clinical Use.
Online Inquiry