AibGenesis™ Mouse Anti-yif1b Antibody (CBMOAB-16561FYB)


Cat: CBMOAB-16561FYB

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-16561FYB Monoclonal Zebrafish (Danio rerio), Chimpanzee (Pan troglodytes), Marmoset, Rhesus (Macaca mulatta) WB, ELISA MO16561FYB 100 µg
CBMOAB-62543FYA Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO62543FYA 100 µg
MO-AB-18628W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO18628W 100 µg
MO-AB-68030W Monoclonal Marmoset WB, ELISA MO68030W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Chimpanzee (Pan troglodytes), Marmoset, Rhesus (Macaca mulatta)
CloneMO16561FYB
SpecificityThis antibody binds to Zebrafish yif1b.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationGolgi apparatus; Endoplasmic reticulum; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionYIF1B (Yip1 Interacting Factor Homolog B, Membrane Trafficking Protein) functions in endoplasmic reticulum-to-Golgi vesicle-mediated transport and regulates the proper organization of the endoplasmic reticulum and the Golgi apparatus. (From uniprot, under CC BY 4.0)
Product OverviewMouse Anti-Zebrafish yif1b Antibody is a mouse antibody against yif1b. It can be used for yif1b detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesProtein YIF1B; YIP1-interacting factor homolog B; yif1
UniProt IDQ5U3G6
Protein RefseqThe length of the protein is 304 amino acids long.
The sequence is show below: MMEYPNQSGFRQRKLLPQVRMRGSAMEPSDPTQLFDDTSSGVNKHEPGRVGKSPDVFSGQNLLSDPMSNLAMAYGSSLASHGKEMMDKNLDRFIPISKLKYYFAVDTVYVGKKLGLLVFPYMHDNWEVNYQQDTPVAPRFDINAPDLYIPVMGFITYVLVAGLALGTQNRFSPEILGIQASSALVWLIIEVLAVLLSLYLVTVNTDLTTIDLVAFSGYKYVGMIVGVVAGLLFGRTGYYLALLWFCASIFVFTIRTLRLKILSEAAAEGRLVRGTKNQLRMYLTMAIAAAQPVFMYWLTFHLVR.
For Research Use Only | Not For Clinical Use.
Online Inquiry