AibGenesis™ Mouse Anti-ythdf3 Antibody (CBMOAB-16603FYB)


Cat: CBMOAB-16603FYB

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-16603FYB Monoclonal Zebrafish (Danio rerio), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset, Rhesus (Macaca mulatta) WB, ELISA MO16603FYB 100 µg
Inquiry
CBMOAB-62581FYA Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO62581FYA 100 µg
Inquiry
MO-AB-09421H Monoclonal Frog (Xenopus laevis) WB, ELISA MO09421C 100 µg
Inquiry
MO-AB-23284W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO23284W 100 µg
Inquiry
MO-AB-68055W Monoclonal Marmoset WB, ELISA MO68055W 100 µg
Inquiry

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset, Rhesus (Macaca mulatta)
CloneMO16603FYB
SpecificityThis antibody binds to Zebrafish ythdf3.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a member of the YTH (YT521-B homology) domain protein family. The YTH domain is common in eukaryotes, is often found in the middle of the protein sequence, and may function in binding to RNA. Alternative splicing results in multiple transcript variants. (From NCBI)
Product OverviewMouse Anti-Zebrafish ythdf3 Antibody is a mouse antibody against ythdf3. It can be used for ythdf3 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative Namesythdf3; YTH N6-Methyladenosine RNA Binding Protein 3
UniProt IDE7FAP0
Protein RefseqThe length of the protein is 600 amino acids long.
The sequence is show below: MSATTVDQRPKGQGNKVQNGSMHQKDAVNDDDFDNYLSSQSNQSNSYPPMSDPYMPSYYAPSIGFPYSLGEAAWSTAGDPPMPYLTTYGQMSNGEHHFIPDGVFSQPGALGNTPPFLSQHGFNFFPGNADFSTWGTSGSQGQSTQSSAYSSSYGYPPSSLGRAIADGQAGFGSDTQLSKVPGLSSIDQGMAGLKLGSDMSAVTKTVGSPLGGTVGMSSMAANSMPPVSSSAPKPTSWAAIARKPAKPQPKMKPKPNMILGSGVTIPPPPIKHNINIGTWEDKGSITKPPLAQQMLPPQQLVQQQLLAQPPPMLQSPLPPQHQPQHQQLQVQSPQHPQHLPPGPPHHHSQPGPPQPLHPSQAQNPLIQNRWVAPRNRGTMFNQNSGMDNFGLGTGVPMSSSPSSSEVHPVLEKLKALNNYNPKDFDWTLKNGRVFIIKSYSEDDIHRSIKYSIWCSTEHGNKRLDGAYRSLSAKGPLYLLFSVNGSGHFCGVAEMKSTVDYNAYAGVWSQDKWKGKFEVKWIFVKDVPNNQLRHIRLENNDNKPVTNSRDTQEVPLEKAKQVLKIIATFKHTTSIFDDFAHYEKRQEEEEAMRRERNRNKQ.
For Research Use Only | Not For Clinical Use.
Online Inquiry