AibGenesis™ Mouse Anti-zar2 Antibody (MO-AB-09436H)


Cat: MO-AB-09436H

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-09436H Monoclonal Frog (Xenopus laevis), Maize (Zea mays) WB, ELISA MO09436C 100 µg
MO-AB-50010W Monoclonal Maize (Zea mays) WB, ELISA MO50010W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityFrog (Xenopus laevis), Maize (Zea mays)
CloneMO09436C
SpecificityThis antibody binds to Frog zar2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewThis product is a mouse antibody against zar2. It can be used for zar2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesZygote arrest 2; Xzar2
UniProt IDC0SPG1
Protein RefseqThe length of the protein is 302 amino acids long.
The sequence is show below: MAGFVYSPYNAYQGYGGNFGQNPHRPQAFPKNKQAAWKSNKSSEPPDYLDHFQRAQLKAILSQVNPNLTPRLRKVNTKEMGVQVNPRVDTGVQCSLGPRTLRRPPPPPSSPVKPTDCARFSRPVAVYSPVVDRRLFSLPQGGRLPKKSLPAPDSQSQPLKDRGPSPEEKEPETKEALEKSPVPGAEEPNEEEPNKPAFQFLEQKYGYFHCKDCKTRWESAYVWCISGSNKVYFKQLCRKCQKGFNPYRVEVIQCQVCAKTRCSCPQKKRHIDLKRPHRQELCGRCKNKKLSCDNTYSYKYIV.
For Research Use Only | Not For Clinical Use.
Online Inquiry