AibGenesis™ Mouse Anti-zbtb34 Antibody (CBMOAB-16685FYB)


Cat: CBMOAB-16685FYB

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-16685FYB Monoclonal Zebrafish (Danio rerio), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset WB, ELISA MO16685FYB 100 µg
MO-AB-09445H Monoclonal Frog (Xenopus laevis) WB, ELISA MO09445C 100 µg
MO-AB-24944W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO24944W 100 µg
MO-AB-68108W Monoclonal Marmoset WB, ELISA MO68108W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset
CloneMO16685FYB
SpecificityThis antibody binds to Zebrafish zbtb34.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Zebrafish zbtb34 Antibody is a mouse antibody against zbtb34. It can be used for zbtb34 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative Nameszbtb34; Zinc Finger And BTB Domain Containing 34
UniProt IDB0V1A3
Protein RefseqThe length of the protein is 508 amino acids long.
The sequence is show below: MEDCGSLIEFDVPEFSNTVLNQLNELRLQGKLCDIIVHIQGQPFRAHKAVLAASSPYFRDHSSLGTMSGLSISVIKSPEVFEQLLAFCYTGRMALRLRDVISFLTAASFLQMQAVIDKCTQILEGIHSKISIPASGEIDPDNECTTSRAGRNGVKDRGIFVNPTEISPSHFSRQNHCMEGQSSGKGIAEEGQSDRGSSDSISEQEASMEVESEQVELIGKDGQVTDVHIKLEKTDRPSYSDSSSAGDDGYHTELVDGEQVLAVSVGSYMPVLSSVGYTYSALPSSCFVSLSSSSPSRSLLSSVRGGRARPKRPVPLPVDMLTQPKPGADEGEPPATTATFENDVRERSLRGQWYPYNERLICIYCGKSFNQKGSLDRHMRLHMGITPFVCKFCGKKYTRKDQLEYHIRGHTDNKPFHCQICGKCFPFQGTLNQHLRKKHMTSGTEINNHTDLLEEAPDGQRGEQEDISEGEAACGAAYPDDLSKKSPSEESGKCSPEEPPASKLLRGY.
For Research Use Only | Not For Clinical Use.
Online Inquiry