AibGenesis™ Mouse Anti-ZCCHC3 Antibody (CBMOAB-62734FYA)


Cat: CBMOAB-62734FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-62734FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset WB, ELISA MO62734FYA 100 µg
MO-AB-14036W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO14036W 100 µg
MO-AB-23142R Monoclonal Cattle (Bos taurus) WB, ELISA MO23142R 100 µg
MO-AB-68164W Monoclonal Marmoset WB, ELISA MO68164W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset
CloneMO62734FYA
SpecificityThis antibody binds to Rhesus ZCCHC3.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus ZCCHC3 Antibody is a mouse antibody against ZCCHC3. It can be used for ZCCHC3 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesZinc finger CCHC domain-containing protein 3; ZCCHC3
UniProt IDH9FCE8
Protein RefseqThe length of the protein is 93 amino acids long.
The sequence is show below: RHLPGAFFLGAERGYSWYKGQPKTCFKCGSRTHMSGSCTQDRCFRCGEEGHLSPYCRKGIVCNLCGKRGHAFAQCPKAVHNSVAAQLTGVAGH.
For Research Use Only | Not For Clinical Use.
Online Inquiry