Mouse Anti-Zebrafish erg Antibody (CBMOAB-75291FYA)
Cat: CBMOAB-75291FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
| Size: | |
| Conjugate: | |
| Inquiry |
- Product Details
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Zebrafish (Danio rerio) |
| Clone | MO75291FYA |
| Specificity | This antibody binds to Zebrafish erg. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
| Cellular Localization | Nucleus |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | This gene encodes a member of the erythroblast transformation-specific (ETS) family of transcriptions factors. All members of this family are key regulators of embryonic development, cell proliferation, differentiation, angiogenesis, inflammation, and apoptosis. The protein encoded by this gene is mainly expressed in the nucleus. It contains an ETS DNA-binding domain and a PNT (pointed) domain which is implicated in the self-association of chimeric oncoproteins. This protein is required for platelet adhesion to the subendothelium, inducing vascular cell remodeling. It also regulates hematopoesis, and the differentiation and maturation of megakaryocytic cells. This gene is involved in chromosomal translocations, resulting in different fusion gene products, such as TMPSSR2-ERG and NDRG1-ERG in prostate cancer, EWS-ERG in Ewing's sarcoma and FUS-ERG in acute myeloid leukemia. More than two dozens of transcript variants generated from combinatorial usage of three alternative promoters and multiple alternative splicing events have been reported, but the full-length nature of many of these variants has not been determined. |
| Product Overview | Mouse Anti-Zebrafish erg Antibody is a mouse antibody against erg. It can be used for erg detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | Erg protein; V-ets erythroblastosis virus E26 oncogene like (Avian); er |
| UniProt ID | Q5PR65 |
| Protein Refseq | The length of the protein is 427 amino acids long. The sequence is show below: MTASAAAELPHSKLLLSAVSVKLEASAGAHRSHCRSPPDDCPGVKGKISPAGNAPVMYSNYMEEKHTPPSSERRVIVPADPGQWSAGHVRQWLDWAVQEYGLPPLDVSLFQGVDGKQLCRMSREELQRLTSSYSADVLLSHLHYLRETPLPHLTSDDVDKALQNSPRLMHARNTGGANFIFPNTPVYPPDASRGASRAGVGYDAVRRSGWTPALPAAKVSQSSAAIMSKTEEQRAQLDPYQILGPTSSRLANPGSGQIQLWQFLLELLSDSCNSSCITWEGTNGEFKMTDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFHGIAQALQPHPPDSSIYKYPAVAADLPYVSSYHPQKMSFMAPHPQAMSVSSSGFFSGPAPYWNTPAAGIYGGPRHPPAHMPSHLGSYY. |
See other products for " ERG "
| MO-AB-34452H | Mouse Anti-Tomato ERG Antibody (MO-AB-34452H) |
| MO-AB-12114R | Mouse Anti-Cattle ERG Antibody (MO-AB-12114R) |
| MO-AB-41622W | Mouse Anti-Guinea pig ERG Antibody (MO-AB-41622W) |
| MO-AB-03362H | Mouse Anti-Frog erg Antibody (MO-AB-03362H) |
| MO-AB-30725W | Mouse Anti-Dog ERG Antibody (MO-AB-30725W) |
| MO-AB-08029Y | Mouse Anti-Rabbit ERG Antibody (MO-AB-08029Y) |
| MO-AB-25706R | Mouse Anti-Pig ERG Antibody (MO-AB-25706R) |
| CBMOAB-28589FYC | Mouse Anti-Arabidopsis ERG Antibody (CBMOAB-28589FYC) |
| CBMOAB-41954FYA | Mouse Anti-Rhesus ERG Antibody (CBMOAB-41954FYA) |
| MO-AB-18873W | Mouse Anti-Chimpanzee ERG Antibody (MO-AB-18873W) |
For Research Use Only | Not For Clinical Use.
Online Inquiry