AibGenesis™ Mouse Anti-Zebrafish gnb5b Antibody (CBMOAB-78184FYA)


Cat: CBMOAB-78184FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Specifications
  • Application Information
  • Target

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio)
CloneMO78184FYA
SpecificityThis antibody binds to Zebrafish gnb5b.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionEnhances GTPase-activating protein (GAP) activity of regulator of G protein signaling (RGS) proteins, hence involved in the termination of the signaling initiated by the G protein coupled receptors (GPCRs) by accelerating the GTP hydrolysis on the G-alpha subunits, thereby promoting their inactivation (Probable). Increases RGS9 GTPase-activating protein (GAP) activity, hence contributes to the deactivation of G protein signaling initiated by D dopamine receptors. Along with gnb5b, plays an important role in neuronal signaling, including in the parasympathetic, but not sympathetic, control of heart rate (PubMed:27523599). (From uniprot, under CC BY 4.0)
Product OverviewMouse Anti-Zebrafish gnb5b Antibody is a mouse antibody against gnb5b. It can be used for gnb5b detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesGuanine nucleotide binding protein (G protein), beta 5; gnb5b; gnb
UniProt IDQ6PBY0
Protein RefseqThe length of the protein is 395 amino acids long.
The sequence is show below: MCDQTFLAITFGPCDKCSENKPLMNIYLKNEPINYCSLCVEMMACQGLAKGETVQSLKAESESLKAKLEEERAKLHDVELHQVAEKMEALGQFVMKTRRTLKGHGNKVLCMDWCRDKRRIVSSSQDGKVIVWDAYTTNKEHAVTMPCTWVMACAYAPSGCAVACGGLDNKCSVYPLSLDKNENLASKKKSVAMHTNYLSSCSFTKSDMQILTSSGDGTCALWDVESGQLLQSFHGHSADVLSLDLAPSETGSTFVSGGCDKKANVWDMRSGQNVQSFETHDSDINSVKYYPSGDAFASGSDDATCRLYDLRADREVAIYSKDSIIFGASSVDFSLSGRLLFAGYNDYNINVWDVLKGTRVAILFGHENRVSTVRVSPDGTAFCSGSWDNTLRIWA.
For Research Use Only | Not For Clinical Use.
Online Inquiry