Mouse Anti-Zebrafish maf1 Antibody (CBMOAB-85721FYA)


Cat: CBMOAB-85721FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio)
CloneMO85721FYA
SpecificityThis antibody binds to Zebrafish maf1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a protein that is similar to Maf1, a Saccharomyces cerevisiae protein highly conserved in eukaryotic cells. Yeast Maf1 is a negative effector of RNA polymerase III (Pol III). It responds to changes in the cellular environment and represses pol III transcription. Biochemical studies identified the initiation factor TFIIIB as a target for Maf1-dependent repression.
Product OverviewMouse Anti-Zebrafish maf1 Antibody is a mouse antibody against maf1. It can be used for maf1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesRepressor of RNA polymerase III transcription MAF1 homolog; maf
UniProt IDQ6PGU2
Protein RefseqThe length of the protein is 247 amino acids long.
The sequence is show below: MKLLENSSFEAINSLLTIETGDCKIIGRIESYSCKMAGDDKQMFKQFCQEGQPHVLEALSPPQSSGISPNKLSHSLDDGEGPLSDKCSRKTLFYLIATLNESFRPDYDFSRTKGHDFSKEPSVNWVFNAVNSSLSAAAGEAYSHLQPQLWEALDKEISLAECDIYSYNPDLDSDPYGEEGNLWSFNYFFYNKRLKRIVFFTCRSVSLFMAPRDSGIGTELDLELDEGSYEEEEEGNMDEERYGALCA.
For Research Use Only | Not For Clinical Use.
Online Inquiry