Mouse Anti-Zebrafish rela Antibody (CBMOAB-95669FYA)


Cat: CBMOAB-95669FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio)
CloneMO95669FYA
SpecificityThis antibody binds to Zebrafish rela.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionNF-kappa-B is a ubiquitous transcription factor involved in several biological processes. It is held in the cytoplasm in an inactive state by specific inhibitors. Upon degradation of the inhibitor, NF-kappa-B moves to the nucleus and activates transcription of specific genes. NF-kappa-B is composed of NFKB1 or NFKB2 bound to either REL, RELA, or RELB. The most abundant form of NF-kappa-B is NFKB1 complexed with the product of this gene, RELA. Four transcript variants encoding different isoforms have been found for this gene.
Product OverviewMouse Anti-Zebrafish rela Antibody is a mouse antibody against rela. It can be used for rela detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative Namesrela; RELA Proto-Oncogene, NF-KB Subunit
UniProt IDE7EXH1
Protein RefseqThe length of the protein is 588 amino acids long.
The sequence is show below: MDGMFHQWGTSQVPQGPPHVEIIEQPKSRGMRFRYKCEGRSAGSIPGEKSNDTTKTHPAIRVHNYSGPVRVRISLVTKNQPYKPHPHELVGKDCKHGYYEADLQERRIHSFQNLGIQCVKKKDVGEAVSCRLQTQNNPFKIPDAKIWEEEFDLNAVRLCFQVSITLSSGDLFPLEPVVSQPIYDNRAPNTAELKICRVNRNSGSCRGGDEIFLLCDKVQKEDIEVRFFLDSWESKGSFSQADVHRQVAIVFRTPPYCDTNLTEPLRVKMQLRRPSDREVSEPMDFQYLPSDPDEHRLMEKRKRTEGMLHNLKLSSIITGSSMSAERRPFPTAKRTLPVSKQPVAASAPASVPAVSAAPPLKPPPTSFFSPPPGQLFTQQKMEPSPLPASSSDIWKYLQAMSVDSQPKAVPVLPFPSGTVSTALPTCLTQAFPTVNLSDLHDCTIKSSTIAEPAPLKDPEPAPEVQSAFTIRMNNTFPDENLPDFPSFSELQGSGDSISNEDIQAILDQSTRQKLPEPCCELPSAADLSWMGYHPNFPGLHGNVTAQDNGAGEAAAAPSVLDDLVELTSMEDDRFMSLFESCDMSTFHF.
For Research Use Only | Not For Clinical Use.
Online Inquiry