AibGenesis™ Mouse Anti-ZFP57 Antibody (CBMOAB-62839FYA)


Cat: CBMOAB-62839FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-62839FYA Monoclonal Rhesus (Macaca mulatta), Pig (Sus scrofa), Rabbit (Oryctolagus cuniculus) WB, ELISA MO62839FYA 100 µg
MO-AB-10559Y Monoclonal Rabbit (Oryctolagus cuniculus) WB, ELISA MO10559Y 100 µg
MO-AB-31334R Monoclonal Pig (Sus scrofa) WB, ELISA MO31334R 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Pig (Sus scrofa), Rabbit (Oryctolagus cuniculus)
CloneMO62839FYA
SpecificityThis antibody binds to Rhesus ZFP57.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein encoded by this gene is a zinc finger protein containing a KRAB domain. Studies in mouse suggest that this protein may function as a transcriptional repressor. Mutations in this gene have been associated with transient neonatal diabetes mellitus type 1 (TNDM1). (From NCBI)
Product OverviewMouse Anti-Rhesus ZFP57 Antibody is a mouse antibody against ZFP57. It can be used for ZFP57 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesZFP57
UniProt IDF7GXZ5
Protein RefseqThe length of the protein is 269 amino acids long.
The sequence is show below: MFEQLKPIEPRDCWREAWVKKKPVTFEDVAVNFTQEEWDCLDASQRVLYQDVMSEIFKNLASVARIFLHKPELITKLEQEEEQWREFVHLPNTEGLSEGKKKELREQHPSLRDEGTSDDKVFLACRGAGQCPLSAPAGSMDRTQVLQASQAGPPFFCRICGKCFSRRSYLYSHQFVHNPKLTNSCSQCGKLYCDASGLSRHRRVHLGYRPHSCSVCGKSFRDQSELKRHQKIHQNQEPVDGNQECTLRIPGTPAELQTPIPRSQRSIQG.
For Research Use Only | Not For Clinical Use.
Online Inquiry