AibGenesis™ Mouse Anti-ZHX1 Antibody (CBMOAB-62863FYA)


Cat: CBMOAB-62863FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-62863FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset WB, ELISA MO62863FYA 100 µg
MO-AB-13795W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO13795W 100 µg
MO-AB-23215R Monoclonal Cattle (Bos taurus) WB, ELISA MO23215R 100 µg
MO-AB-68279W Monoclonal Marmoset WB, ELISA MO68279W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset
CloneMO62863FYA
SpecificityThis antibody binds to Rhesus ZHX1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe members of the zinc fingers and homeoboxes gene family are nuclear homodimeric transcriptional repressors that interact with the A subunit of nuclear factor-Y (NF-YA) and contain two C2H2-type zinc fingers and five homeobox DNA-binding domains. This gene encodes member 1 of this gene family. In addition to forming homodimers, this protein heterodimerizes with members 2 and 3 of the zinc fingers and homeoboxes family. Alternative splicing results in multiple transcript variants. Read-through transcription also exists between this gene and the downstream chromosome 8 open reading frame 76 (C8orf76) gene. (From NCBI)
Product OverviewMouse Anti-Rhesus ZHX1 Antibody is a mouse antibody against ZHX1. It can be used for ZHX1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesZHX1; ZHX1
UniProt IDA2D6B8
Protein RefseqThe length of the protein is 501 amino acids long.
The sequence is show below: NLIPKVLIPVNSIPTYNAALDNNPLLLNTYNKFPYPTMSEITVLSAQAKYTEEQIKIWFSAQRLKHGVSWTPEEVEEARRKQFNGTVHTVPQTITVIPTHISTGSNGLPSILQTCQIVGQPGLVLTQVAGTNSLPVTAPIALTVAGVPSQNNVQKSQVPAAQPTAEAKPATAAVPASQSVKHETALVNPDSFGIRAKKTKEQLAELKVSYLKNQFPHDSEXIXLMKITGLTKGEIKKWFSDTRYNQRNSKSNQCLHLNNDSSTTIIIDSSDETTESPSVGTAQPKQSWNPFPDFTPQKFKEXXAEXXXVLQASFLNSSVLTDEELNRLRAQTKLTRREIDAWFTEKKKSKALKEEKMEIDESNAGSSKEEAGETSPGDESGAPKSGSTGKICKKTPEQLHMLKSAFVRTQWPSPEEYDKLAKESGLARTDIVSWFGDTRYAWKNGNLKWYYYYQSANSSSMNGLSSLRKRGRGRPKGRGRGRPRGRPXGSKRINNWDRGPS.
For Research Use Only | Not For Clinical Use.
Online Inquiry