AibGenesis™ Mouse Anti-ZNF12 Antibody (CBMOAB-62938FYA)


Cat: CBMOAB-62938FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-62938FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Pig (Sus scrofa) WB, ELISA MO62938FYA 100 µg
MO-AB-07085W Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO07085W 100 µg
MO-AB-23229R Monoclonal Cattle (Bos taurus) WB, ELISA MO23229R 100 µg
MO-AB-31354R Monoclonal Pig (Sus scrofa) WB, ELISA MO31354R 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Pig (Sus scrofa)
CloneMO62938FYA
SpecificityThis antibody binds to Rhesus ZNF12.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene is a member of the krueppel C2H2-type zinc-finger protein family and encodes a protein with eight C2H2-type zinc fingers and a KRAB domain. This nuclear protein is involved in developmental control of gene expression. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. (From NCBI)
Product OverviewMouse Anti-Rhesus ZNF12 Antibody is a mouse antibody against ZNF12. It can be used for ZNF12 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesZNF12
UniProt IDF7EP09
Protein RefseqThe length of the protein is 502 amino acids long.
The sequence is show below: MNKSLGPVSFKDVAVDFTQEEWQQLDPEQKITYRDVMLENYSNLVSVGYHIIKPDVISKLEQGEEPWIVEGEFLLQSYPDEVWQADDLIERIQEGENKPSRQTVFTETLIEERGNVPRKTFDVETNAVPSGKTAYRNSLCDSCEKCLASVSEYISSDGSYARMKADECSGCGKSLLHIKLEKTHPGDKAYEFNQNGKPYTLNEESLYQKIHILEKPFEYIECQKAFQKDTVFVNHMEEKPYKWNGSEIAFLQMSDLTVHQASHMEMKPYECSECGKSFCKKSKFIIHQRTHTGEKPYECNQCGKSFCQKGTLTVHQRTHTGEKPYECNECGKNFYQKLHLIQHQRTHSGEKPYECSYCGKSFCQKTHLTQHQRTHSGERPYVCHDCGKTFSQKSALNDHQKIHTGVKLYKCSECGKCFCRKSTLTTHLRTHTGEKPYECNECGKFFSRLSYLTVHYRTHSGEKPYEYCTECGKKFYHKSAFNSHQRIHRRGNMNVIDVGRLL.
For Research Use Only | Not For Clinical Use.
Online Inquiry