AibGenesis™ Mouse Anti-ZNF14 Antibody (CBMOAB-62958FYA)


Cat: CBMOAB-62958FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-62958FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus) WB, ELISA MO62958FYA 100 µg
Inquiry
MO-AB-23233R Monoclonal Cattle (Bos taurus) WB, ELISA MO23233R 100 µg
Inquiry

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus)
CloneMO62958FYA
SpecificityThis antibody binds to Rhesus ZNF14.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein encoded by this gene contains a zinc finger and a Kruppel-associated box (KRAB) domain. KRAB domain is known to be involved in the transcriptional repression of a number of zinc finger proteins. (From NCBI)
Product OverviewMouse Anti-Rhesus ZNF14 Antibody is a mouse antibody against ZNF14. It can be used for ZNF14 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesZinc finger protein 14; ZNF14
UniProt IDH9FI90
Protein RefseqThe length of the protein is 119 amino acids long.
The sequence is show below: GKSFRCSSYFRIHERSHTGEKPYECKQCGKVFIRSSSFRLHERTHTGEKPYECKLCGKAFSFSSSLREHEKIHTGNKPFECKRCGKAFLRSSQIRLHERTHTGEKPYQCKQCGKAFISS.
For Research Use Only | Not For Clinical Use.
Online Inquiry