AibGenesis™ Mouse Anti-ZNF154 Antibody (CBMOAB-62970FYA)


Cat: CBMOAB-62970FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-62970FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes) WB, ELISA MO62970FYA 100 µg
MO-AB-10036W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO10036W 100 µg
MO-AB-23237R Monoclonal Cattle (Bos taurus) WB, ELISA MO23237R 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes)
CloneMO62970FYA
SpecificityThis antibody binds to Rhesus ZNF154.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a protein that belongs to the zinc finger Kruppel family of transcriptional regulators, whose members are thought to function in normal and abnormal cell growth and differentiation. Hypermethylation of this gene is associated with the recurrence of non muscle invasive bladder cancer. Alternative splicing results in multiple transcript variants. (From NCBI)
Product OverviewMouse Anti-Rhesus ZNF154 Antibody is a mouse antibody against ZNF154. It can be used for ZNF154 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesZinc finger protein 154; ZNF154
UniProt IDH9FG23
Protein RefseqThe length of the protein is 117 amino acids long.
The sequence is show below: KTHYNCGEYTKAFSRKHTLVQQQRTLTTERCYICSECGKSFSKSYSLNDHWRVHTGEKPYECGECGKSFRQSSSLIQHRRVHTAVRPHECDECGKLFSNKSNLIKHRRVHTGERPYE.
For Research Use Only | Not For Clinical Use.
Online Inquiry