AibGenesis™ Mouse Anti-ZNF195 Antibody (CBMOAB-62997FYA)


Cat: CBMOAB-62997FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-62997FYA Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO62997FYA 100 µg
Inquiry
MO-AB-07104W Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO07104W 100 µg
Inquiry

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta)
CloneMO62997FYA
SpecificityThis antibody binds to Rhesus ZNF195.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a protein belonging to the Krueppel C2H2-type zinc-finger protein family. These family members are transcription factors that are implicated in a variety of cellular processes. This gene is located near the centromeric border of chromosome 11p15.5, next to an imprinted domain that is associated with maternal-specific loss of heterozygosity in Wilms' tumors. Alternative splicing results in multiple transcript variants. (From NCBI)
Product OverviewMouse Anti-Rhesus ZNF195 Antibody is a mouse antibody against ZNF195. It can be used for ZNF195 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesZNF195
UniProt IDF6YJA6
Protein RefseqThe length of the protein is 628 amino acids long.
The sequence is show below: TLLTFRDVAIEFSLEEWKCLDPAQQNLYRDVMLENYRNLFSIGLTVSKPGLITCLEQRKEPWNVKRQEAVDGRPEMGFHHATQACLELLGSSDLPASASQSAEITGVNHCAQPALKVSVDKFTALCSPGVLQTLKWFLEFRCIFSLAMSSHVTQDLLPEQGIQDAFPKSILRGYGNCGLDNLHLRKDWESLNECKLQKDYNELNQCSSTTHSKIFQCNKYVKIFNNFSNLHRHNISNTGEKPFKCQECGKSFQMFSFLTEHQKIHTGKKFQKCGECGKTFIQCSHFTEHENIDTGEKPYRCQECDKVFKTCSVLTKNRIYAGGEHYKCEEFGKVFNQYSHLTEHERGTEEKPCKYEECSSVFISCSSLSNQQLILAGEKLSKCETWYRGFNHSPNPSKHQRNEIGGKPFKCEECDSIFKWFSDLTKHKRIHTGEKPYKCEECGKAYTQSSHLSEHRRIHTGEKPYQCEECGKVFRTCSSLSNHKRTHSEEKPYTCEECGNIFKQLSDLTKHKKTHTGEKPYKCDECGKNFTQSSNLIVHKRIHTGEKPYKCEECGRVFMWFSDITKHKKTHTGEKPYKCDECGKNFTQSSNLIVHKRIHTGEKPYKCEKCGKAFTQFSHLTVHESIHT.
For Research Use Only | Not For Clinical Use.
Online Inquiry