AibGenesis™ Mouse Anti-ZNF234 Antibody (CBMOAB-63053FYA)


Cat: CBMOAB-63053FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-63053FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis) WB, ELISA MO63053FYA 100 µg
MO-AB-09506H Monoclonal Frog (Xenopus laevis) WB, ELISA MO09506C 100 µg
MO-AB-23259R Monoclonal Cattle (Bos taurus) WB, ELISA MO23259R 100 µg
MO-AB-25769W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO25769W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis)
CloneMO63053FYA
SpecificityThis antibody binds to Rhesus ZNF234.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus ZNF234 Antibody is a mouse antibody against ZNF234. It can be used for ZNF234 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesZinc finger protein 234; ZNF234
UniProt IDH9FJA5
Protein RefseqThe length of the protein is 249 amino acids long.
The sequence is show below: HTGEKPFKCVECGKGFSRRSTLTVHCKLHSGEKPYNCEECGRAFIHASHLQEHQRIHTGEKPFKCDTCGKNFRRRSALNNHCMVHTGEKPYKCEDCGKCFTCSSNLRIHQRVHTGEKPYKCEECGKCFIQPSQFQAHQRIHTGEKPYVCKVCGKGFIYSSSFQAHQGVHTGEKPYKCNECGKSFRMKIHYQVHLVVHTGEKPYKCEVCGKAFRQSSYLKIHLKAHSVQKPYKCEECGQGFNQSSRLQIH.
For Research Use Only | Not For Clinical Use.
Online Inquiry