AibGenesis™ Mouse Anti-ZNF264 Antibody (CBMOAB-63081FYA)


Cat: CBMOAB-63081FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-63081FYA Monoclonal Rhesus (Macaca mulatta), Marmoset WB, ELISA MO63081FYA 100 µg
MO-AB-68401W Monoclonal Marmoset WB, ELISA MO68401W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Marmoset
CloneMO63081FYA
SpecificityThis antibody binds to Rhesus ZNF264.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a zinc finger protein and belongs to the krueppel C2H2-type zinc-finger protein family. Zinc finger proteins are often localized in the nucleus, bind nucleic acids, and regulate transcription. (From NCBI)
Product OverviewMouse Anti-Rhesus ZNF264 Antibody is a mouse antibody against ZNF264. It can be used for ZNF264 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesZinc finger protein 264; ZNF264
UniProt IDH9FDI8
Protein RefseqThe length of the protein is 434 amino acids long.
The sequence is show below: AVLTDRAQVSVTFDDVAVTFTKEEWGQLDLAQRTLYQEVMLENCGLLVSLGCPIPRPELIYHLEHGQEPWTRKEDLSQDTCPGNKGKPKTTEPTTCEPVLSEGISLQGQLTEGNSVYSQLGQAEDQDGLSEMQEGHFRPGVDPQEKPPGKMSPECDGLGTADGVCLRIGQEQVSPGDTVHSHNSCESGKDPMIQEEENIFKCSECGKVFNKKHLLAGHEKIHSGVKPYECTECGKTFSKSTYLLQHHMVHTGEKPYKCMECGKAFNRKSHLTQHQRIHSGEKPYKCSECGKAFTHRSTFVLHNRSHTGEKPFVCKECGKAFRDRPGFIRHYIIHSGENPYECFECGKVFKHRSYLMWHQQTHTGEKPYECSECGKAFCESAALIHHYVIHTGEKPFECLECGKAFNHRSYLKRHQRIHTGEKPFVCSECGKAFT.
For Research Use Only | Not For Clinical Use.
Online Inquiry