AibGenesis™ Mouse Anti-ZNF33A Antibody (CBMOAB-63161FYA)


Cat: CBMOAB-63161FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-63161FYA Monoclonal Rhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis) WB, ELISA MO63161FYA 100 µg
MO-AB-07139W Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO07139W 100 µg
MO-AB-09521H Monoclonal Frog (Xenopus laevis) WB, ELISA MO09521C 100 µg
MO-AB-22547W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO22547W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis)
CloneMO63161FYA
SpecificityThis antibody binds to Rhesus ZNF33A.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus ZNF33A Antibody is a mouse antibody against ZNF33A. It can be used for ZNF33A detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesZinc finger protein 33B; ZNF33A
UniProt IDH9EYW6
Protein RefseqThe length of the protein is 39 amino acids long.
The sequence is show below: MNKVEQKFQGSVSFEDVTVGFSQEEWQHLDPAQRTLYRD.
For Research Use Only | Not For Clinical Use.
Online Inquiry