AibGenesis™ Mouse Anti-ZNF383 Antibody (CBMOAB-63196FYA)


Cat: CBMOAB-63196FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-63196FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus) WB, ELISA MO63196FYA 100 µg
Inquiry
MO-AB-23288R Monoclonal Cattle (Bos taurus) WB, ELISA MO23288R 100 µg
Inquiry

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus)
CloneMO63196FYA
SpecificityThis antibody binds to Rhesus ZNF383.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein encoded by this gene is a KRAB-related zinc finger protein that inhibits the transcription of some MAPK signaling pathway genes. The repressor activity resides in the KRAB domain of the encoded protein. (From NCBI)
Product OverviewMouse Anti-Rhesus ZNF383 Antibody is a mouse antibody against ZNF383. It can be used for ZNF383 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesZNF383
UniProt IDF6QVW9
Protein RefseqThe length of the protein is 473 amino acids long.
The sequence is show below: MAEGSVMFSDVSIDFSQEEWDCLDPVQRDLYRDVMLENYSNLVSMGLYTPKPQVISLLEQGKEPWMVGRELTRGLCSDLESMCETKLLSLKKEVYEIELCQREIMGLTKHGLEYSSFGDVLEYRSRLAKQLGYPNGHFSQEIFTPEYMPTFIQQTFLTLQQIMNNEDRPFECKKCGKAFSQNSQFIQHQRIHIGEKSYECKECGKFFSCGSHVTRHLKIHTGEKPFECKECGKAFSCSSYLSQHQRIHTGKKPYECKECGKAFSYCSNLIDHQRIHTGEKPYACKVCGKAFTKSSQLFQHVRIHTGEKPYECKECGKAFTQSSKLVQHQRIHTGEKPYECKECGKAFSSGSALTNHQRIHTGEKPYDCKECGKAFTQSSQLRQHQRIHAGEKPFECLECGKAFTQNSQLFQHQRIHTDEKPYECNECGKAFNKCSNLTRHLRIHTGEKPYNCKECGKAFSSGSDLIRHQGIHT.
For Research Use Only | Not For Clinical Use.
Online Inquiry