AibGenesis™ Mouse Anti-ZNF501 Antibody (CBMOAB-63311FYA)


Cat: CBMOAB-63311FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-63311FYA Monoclonal Rhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Marmoset WB, ELISA MO63311FYA 100 µg
MO-AB-07178W Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO07178W 100 µg
MO-AB-21149W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO21149W 100 µg
MO-AB-68503W Monoclonal Marmoset WB, ELISA MO68503W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Marmoset
CloneMO63311FYA
SpecificityThis antibody binds to Rhesus ZNF501.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus ZNF501 Antibody is a mouse antibody against ZNF501. It can be used for ZNF501 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesZNF501
UniProt IDF7CWG7
Protein RefseqThe length of the protein is 207 amino acids long.
The sequence is show below: MKHRRVNMQKKPSKCSECGKFFTQRSSLTQHQRIHRGEKPYVCTECGSCFRKQSNLTQHLRIHTGEKPFKCNECDKAFQTKAILVQHLRIHTGEKPYKCNECGKAFCQSPSLIKHQRIHTGEKPYKCTECGKAFSQSNSSLVEHERTHTGEKLYKCSECEKTFRKQAHLSEHYRIHTGEKPYECVGCGKSFRHSSALLRHQRLHAGE.
For Research Use Only | Not For Clinical Use.
Online Inquiry