AibGenesis™ Mouse Anti-ZNF524 Antibody (CBMOAB-63332FYA)


Cat: CBMOAB-63332FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-63332FYA Monoclonal Rhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Marmoset WB, ELISA MO63332FYA 100 µg
MO-AB-15450W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO15450W 100 µg
MO-AB-68516W Monoclonal Marmoset WB, ELISA MO68516W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Marmoset
CloneMO63332FYA
SpecificityThis antibody binds to Rhesus ZNF524.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus ZNF524 Antibody is a mouse antibody against ZNF524. It can be used for ZNF524 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesZinc finger protein 524; ZNF524
UniProt IDH9FQB9
Protein RefseqThe length of the protein is 264 amino acids long.
The sequence is show below: MDTPSPDPLPSPLPGEEAKPLALPPPVPRGRRGRRPGGAASSHRTLKASSLPRKRGRPPKSGQEPPLVQVQGVAAPVGSSGGNDLLLIDDQGVPYTVSEGSAAGPQGSGPRKAPHFCPVCLRAFPYLSDLERHSISHSELKPHQCKVCGKTFKRSSHLRRHCNIHAGLRPFRCPLCPRRFREAGELAHHHRVHSGERPYQCPICRLRFTEANTLRRHAKRKHPEAMGVPLCAPDPGSEPPWDEEGIPATAGAEEEETEGKGEPA.
For Research Use Only | Not For Clinical Use.
Online Inquiry