AibGenesis™ Mouse Anti-ZNF581 Antibody (CBMOAB-63403FYA)


Cat: CBMOAB-63403FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-63403FYA Monoclonal Rhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Ferret (Mustela Putorius Furo), Marmoset WB, ELISA MO63403FYA 100 µg
MO-AB-20399W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO20399W 100 µg
MO-AB-36038W Monoclonal Ferret (Mustela Putorius Furo) WB, ELISA MO36038W 100 µg
MO-AB-68552W Monoclonal Marmoset WB, ELISA MO68552W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Ferret (Mustela Putorius Furo), Marmoset
CloneMO63403FYA
SpecificityThis antibody binds to Rhesus ZNF581.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus ZNF581 Antibody is a mouse antibody against ZNF581. It can be used for ZNF581 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesZinc finger protein 581; ZNF581
UniProt IDI0FIF3
Protein RefseqThe length of the protein is 197 amino acids long.
The sequence is show below: MLVLPSPCPQPLAFSSVETMEGPPRRTCRSPEPGPSSSIGSPQPSSPPRPNHYLLIDTQGVPYTVLVDEESQREPGANGASGQKKCYSCPVCSRVFEYMSYLQRHSITHSEVKPFECDICGKAFKRASHLARHHSIHLAGGGRPHGCPLCPRRFRDAGELAQHSRVHSGERPFQCPHCPRRFMEQNTLQKHTRWKHP.
For Research Use Only | Not For Clinical Use.
Online Inquiry