AibGenesis™ Mouse Anti-ZNF585B Antibody (CBMOAB-63412FYA)


Cat: CBMOAB-63412FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-63412FYA Monoclonal Rhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset WB, ELISA MO63412FYA 100 µg
MO-AB-09535H Monoclonal Frog (Xenopus laevis) WB, ELISA MO09535C 100 µg
MO-AB-21301W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO21301W 100 µg
MO-AB-68560W Monoclonal Marmoset WB, ELISA MO68560W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset
CloneMO63412FYA
SpecificityThis antibody binds to Rhesus ZNF585B.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus ZNF585B Antibody is a mouse antibody against ZNF585B. It can be used for ZNF585B detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesZinc finger protein 585A; ZNF585B
UniProt IDH9F873
Protein RefseqThe length of the protein is 367 amino acids long.
The sequence is show below: IHTGEKSYICMKCGLAFIQKAHLIAYQIIHTAEKPYKCGHCGKLFTSKSQLHVHKRIHTGEKPYMCNKCGKAFTNRSNLITHQKTHTGEKSYICSKCGKAFTQRSDLITHQRIHTGEKPYECSTCGKAFTQKSHLNIHQKIHTGERQYECHECGKAFNRKSILIVHQKIHTGEKPYVCTECGRAFIRKSNFVTHQRIHTGERPYECSDCGKSFTSKSQLLVHQPVHTGEKPYVCAECGKAFSGRSNLSKHQKTHTGEKPYICSECGKTFRQKSELITHHRIHTGEKPYECSDCGKSFTKKSQLQVHQRIHTGEKPYVCAECGKAFSNRSNLNKHQTTHTGDKPYKCGICGKGFVQKSVFSVHQSSHT.
For Research Use Only | Not For Clinical Use.
Online Inquiry