AibGenesis™ Mouse Anti-ZNF778 Antibody (MO-AB-07258W)


Cat: MO-AB-07258W

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-07258W Monoclonal Rhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Marmoset WB, ELISA MO07258W 100 µg
MO-AB-10859W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO10859W 100 µg
MO-AB-68623W Monoclonal Marmoset WB, ELISA MO68623W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Marmoset
CloneMO07258W
SpecificityThis antibody binds to Rhesus ZNF778.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein encoded by this gene is a member of the krueppel C2H2-type zinc-finger protein family, and it contains one KRAB domain and eighteen C2H2-type zinc fingers. This gene is a candidate gene for autism and variable cognitive impairment in the 16q24.3 microdeletion syndrome. Alternatively spliced transcript variants have been found for this gene. (From NCBI)
Product OverviewMouse Anti-Rhesus ZNF778 Antibody is a mouse antibody against ZNF778. It can be used for ZNF778 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesZinc finger protein 778 isoform 1; ZNF778
UniProt IDH9F4R3
Protein RefseqThe length of the protein is 216 amino acids long.
The sequence is show below: YNRVYLLNEHVKTHTEEKPFICMICGKSFRNSSCLNKHIQIHTGIKPYECKDCGKTFTVSSSLTEHIRTHTGEKPYECRVCGKAFTTSSHLVVHIRTHTGEKPYICKECGKAFASSSHLIEHRRTHTGEKPYVCNECGKAFRASSHLRKHGRIHTGQKPYKCKECGKAYSRFYLLKEHLKTYTEEQLFVCKNCGKSFKNSSCLNHHAQIHTDEKPY.
For Research Use Only | Not For Clinical Use.
Online Inquiry