AibGenesis™ Mouse Anti-znhit3 Antibody (CBMOAB-18221FYB)


Cat: CBMOAB-18221FYB

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-18221FYB Monoclonal Zebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Rat (Rattus norvegicus) WB, ELISA MO18221FYB 100 µg
MO-AB-09555H Monoclonal Frog (Xenopus laevis) WB, ELISA MO09555C 100 µg
MO-AB-13674W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO13674W 100 µg
MO-AB-23378R Monoclonal Cattle (Bos taurus) WB, ELISA MO23378R 100 µg
MO-AB-30141H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO30141C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Rat (Rattus norvegicus)
CloneMO18221FYB
SpecificityThis antibody binds to Zebrafish znhit3.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Zebrafish znhit3 Antibody is a mouse antibody against znhit3. It can be used for znhit3 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesZgc:56688; znhit3; zgc:5668
UniProt IDQ7ZUF9
Protein RefseqThe length of the protein is 151 amino acids long.
The sequence is show below: MQLCGVCSELVPKYRCPACRIRYCSVSCFKRHKEDDSCDPVKESDPASSKPAAVSNAEEPWTVEDLLDEDSQTDKVPLQRLQQLGDSEALKGLLRNPHLRQLMMSVDSAENKAKAMKDAMQEPLFVEFADQCLKIIEPSETDNNEDDDDEY.
For Research Use Only | Not For Clinical Use.
Online Inquiry