AibGenesis™ Mouse Anti-ZRANB1 Antibody (MO-AB-23400R)


Cat: MO-AB-23400R

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-23400R Monoclonal Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset WB, ELISA MO23400R 100 µg
MO-AB-23567W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO23567W 100 µg
MO-AB-68658W Monoclonal Marmoset WB, ELISA MO68658W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset
CloneMO23400R
SpecificityThis antibody binds to Cattle ZRANB1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionSpecifically hydrolyzes Lys-29-linked and Lys-33-linked diubiquitin. Also cleaves Lys-63-linked chains, but with 40-fold less efficiency compared to Lys-29-linked ones. Positive regulator of the Wnt signaling pathway that deubiquitinates APC protein, a negative regulator of Wnt-mediated transcription. Plays a role in the regulation of cell morphology and cytoskeletal organization. Required in the stress fiber dynamics and cell migration. May also modulate TNF-alpha signaling. (From uniprot, under CC BY 4.0)
Product OverviewThis product is a mouse antibody against ZRANB1. It can be used for ZRANB1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesUbiquitin thioesterase ZRANB1; EC 3.4.19.12; Zinc finger Ran-binding domain-containing protein 1; ZRANB1
UniProt IDA6QP16
Protein RefseqThe length of the protein is 708 amino acids long.
The sequence is show below: MSERGIKWACEYCTYENWPSAIKCTMCRAQRPSGTIITEDPFKSGSSDVGRDWDPSSTEGGSSPLICPDSSARPRVKSSYSMENANKWSCHMCTYLNWPRAIRCTQCLSQRRTRSPTESPQSSGSGSRPVAFSVDPCEEYNDRNKLNTRTQHWTCSICTYENWAKAKKCVVCDHPRPNNIEAIEFAETEEASSIINEQDRARWRGSCSSGNSQRRSPPTMKRDSEVKMDFQRIELAGAVGSKEELEVDFKKLKQI.
For Research Use Only | Not For Clinical Use.
Online Inquiry