AibGenesis™ Mouse Anti-ZSCAN16 Antibody (CBMOAB-63718FYA)


Cat: CBMOAB-63718FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-63718FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Marmoset WB, ELISA MO63718FYA 100 µg
MO-AB-23407R Monoclonal Cattle (Bos taurus) WB, ELISA MO23407R 100 µg
MO-AB-68664W Monoclonal Marmoset WB, ELISA MO68664W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Marmoset
CloneMO63718FYA
SpecificityThis antibody binds to Rhesus ZSCAN16.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus ZSCAN16 Antibody is a mouse antibody against ZSCAN16. It can be used for ZSCAN16 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesZinc finger and SCAN domain-containing protein 16; ZSCAN16
UniProt IDH9FC80
Protein RefseqThe length of the protein is 261 amino acids long.
The sequence is show below: QFLSILPKDLQAWVQAHHPETGEEAVTVLEDLERELDEPGKQVPGNSERQDILMDKLAPLGRPYESLTVQLHPKKTQLEQEAGKPQRNGDKTRTKNEELFQKEDMPKDKEFLGEINDRLNKDTPQHPKSKDIMENEGRSEWQQRERRRYKCDECGKSFSHSSDLSKHRRTHTGEKPYKCDECGKAFIQRSHLIGHHRVHTGVKPYKCKECGKDFSGRTGLIQHQRIHTGEKPYECDECGRPFRVSSALIRHQRIHTANKLY.
For Research Use Only | Not For Clinical Use.
Online Inquiry