AibGenesis™ Mouse Anti-cspD Antibody (CBMOAB-0444YC)


Cat: CBMOAB-0444YC

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-0444YC Monoclonal E. coli (Escherichia coli ), Cucumber (Cucumis sativus) WB, ELISA MO0444YC 100 µg
Inquiry
MO-AB-28388W Monoclonal Cucumber (Cucumis sativus) WB, ELISA MO28388W 100 µg
Inquiry

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityE. coli (Escherichia coli ), Cucumber (Cucumis sativus)
CloneMO0444YC
SpecificityThis antibody binds to Escherichia coli K-12 cspD.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-E. coli cspD Antibody is a mouse antibody against cspD. It can be used for cspD detection in Western Blot and Enzyme-Linked Immunosorbent Assay.
Alternative NamesCold shock-like protein CspD; CSP-D; cspD; cspH ybjA; b0880 JW0864
UniProt IDP0A968
Protein RefseqThe length of the protein is 74 amino acids long. The sequence is show below: MEKGTVKWFNNAKGFGFICPEGGGEDIFAHYSTIQMDGYRTLKAGQSVQFDVHQGPKGNHASVIVPVEVEAAVA.
For Research Use Only | Not For Clinical Use.
Online Inquiry