Mouse Anti-E. coli accA Antibody (CBMOAB-0012YC)


Cat: CBMOAB-0012YC
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityE. coli (Escherichia coli )
CloneMO0012YC
SpecificityThis antibody binds to Escherichia coli K-12 accA.
FormatLyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionComponent of the acetyl coenzyme A carboxylase (ACC) complex. First, biotin carboxylase catalyzes the carboxylation of biotin on its carrier protein (BCCP) and then the CO group is transferred by the carboxyltransferase to acetyl-CoA to form malonyl-CoA.
Product OverviewMouse Anti-E. coli accA (clone MO0012YC) Antibody (CBMOAB-0012YC) is a mouse antibody against accA. It can be used for accA detection in Western Blot and Enzyme-Linked Immunosorbent Assay.
Alternative NamesAcetyl-coenzyme A carboxylase carboxyl transferase subunit alpha; ACCase subunit alpha; Acetyl-CoA carboxylase carboxyltransferase subunit alpha; EC 6.4.1.2; accA; b0185 JW0180
UniProt IDP0ABD5
Protein RefseqThe length of the protein is 319 amino acids long. The sequence is show below: MSLNFLDFEQPIAELEAKIDSLTAVSRQDEKLDINIDEEVHRLREKSVELTRKIFADLGAWQIAQLARHPQRPYTLDYVRLAFDEFDELAGDRAYADDKAIVGGIARLDGRPVMIIGHQKGRETKEKIRRNFGMPAPEGYRKALRLMQMAERFKMPIITFIDTPGAYPGVGAEERGQSEAIARNLREMSRLGVPVVCTVIGEGGSGGALAIGVGDKVNMLQYSTYSVISPEGCASILWKSADKAPLAAEAMGIIAPRLKELKLIDSIIPEPLGGAHRNPEAMAASLKAQLLADLADLDVLSTEDLKNRRYQRLMSYGYA.
For Research Use Only | Not For Clinical Use.

Online Inquiry