Connect with Us at the Upcoming Events

Creative Biolabs is excited to greet you at the upcoming international conferences. Meet our team at the 13th Annual World ADC San Diego and the 13th Annual World Multispecific Summit in September (booth number to be updated) for expert consultation on your drug discovery. Shoot an email to arrange an in-person meeting!

Mouse Anti-E. coli accA Antibody (CBMOAB-0012YC)


Cat: CBMOAB-0012YC
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityE. coli (Escherichia coli )
CloneMO0012YC
SpecificityThis antibody binds to Escherichia coli K-12 accA.
FormatLyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionComponent of the acetyl coenzyme A carboxylase (ACC) complex. First, biotin carboxylase catalyzes the carboxylation of biotin on its carrier protein (BCCP) and then the CO group is transferred by the carboxyltransferase to acetyl-CoA to form malonyl-CoA.
Product OverviewMouse Anti-E. coli accA (clone MO0012YC) Antibody (CBMOAB-0012YC) is a mouse antibody against accA. It can be used for accA detection in Western Blot and Enzyme-Linked Immunosorbent Assay.
Alternative NamesAcetyl-coenzyme A carboxylase carboxyl transferase subunit alpha; ACCase subunit alpha; Acetyl-CoA carboxylase carboxyltransferase subunit alpha; EC 6.4.1.2; accA; b0185 JW0180
UniProt IDP0ABD5
Protein RefseqThe length of the protein is 319 amino acids long. The sequence is show below: MSLNFLDFEQPIAELEAKIDSLTAVSRQDEKLDINIDEEVHRLREKSVELTRKIFADLGAWQIAQLARHPQRPYTLDYVRLAFDEFDELAGDRAYADDKAIVGGIARLDGRPVMIIGHQKGRETKEKIRRNFGMPAPEGYRKALRLMQMAERFKMPIITFIDTPGAYPGVGAEERGQSEAIARNLREMSRLGVPVVCTVIGEGGSGGALAIGVGDKVNMLQYSTYSVISPEGCASILWKSADKAPLAAEAMGIIAPRLKELKLIDSIIPEPLGGAHRNPEAMAASLKAQLLADLADLDVLSTEDLKNRRYQRLMSYGYA.
For Research Use Only | Not For Clinical Use.

Online Inquiry