Mouse Anti-E. coli crp Antibody (CBMOAB-0427YC)
Cat: CBMOAB-0427YC
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
Size: | |
Conjugate: | |
Inquiry |
- Product Details
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | E. coli (Escherichia coli ) |
Clone | MO0427YC |
Specificity | This antibody binds to Escherichia coli K-12 crp. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | A global transcription regulator. Complexes with cyclic AMP (cAMP) which allosterically activates DNA binding (to consensus sequence 5'-AAATGTGATCTAGATCACATTT-3') to directly regulate the transcription of about 300 genes in about 200 operons and indirectly regulate the expression of about half the genome. There are 3 classes of CRP promoters; class I promoters have a single CRP-binding site upstream of the RNA polymerase (RNAP)-binding site, whereas in class II promoters the single CRP- and RNAP-binding site overlap, CRP making multiple contacts with RNAP. Class III promoters require multiple activator molecules, including at least one CRP dimer. It can act as an activator, repressor, coactivator or corepressor. Induces a severe bend in DNA (about 87 degrees), bringing upstream promoter elements into contact with RNAP. Acts as a negative regulator of its own synthesis as well as for adenylate cyclase (cyaA), which generates cAMP. High levels of active CRP are detrimental to growth (PubMed:16260780). Plays a major role in carbon catabolite repression (CCR). CCR involves cAMP, adenylate cyclase (cyaA), CRP and the EIIA-Glc component of the PTS (crr). In the presence of glucose EIIA-Glc is dephosphorylated, and does not activate adenylate cyclase, leading to reduced cAMP and thus decreased CRP activity. Also plays a role in many other processes (see PubMed:22573269). |
Product Overview | Mouse Anti-E. coli crp Antibody is a mouse antibody against crp. It can be used for crp detection in Western Blot and Enzyme-Linked Immunosorbent Assay. |
Alternative Names | cAMP-activated global transcriptional regulator CRP; Catabolite activator protein; CAP; Catabolite gene activator; cAMP receptor protein; CRP; cAMP regulatory protein; crp; cap csm; b3357 JW5702 |
UniProt ID | P0ACJ8 |
Protein Refseq | The length of the protein is 210 amino acids long. The sequence is show below: MVLGKPQTDPTLEWFLSHCHIHKYPSKSTLIHQGEKAETLYYIVKGSVAVLIKDEEGKEMILSYLNQGDFIGELGLFEEGQERSAWVRAKTACEVAEISYKKFRQLIQVNPDILMRLSAQMARRLQVTSEKVGNLAFLDVTGRIAQTLLNLAKQPDAMTHPDGMQIKITRQEIGQIVGCSRETVGRILKMLEDQNLISAHGKTIVVYGTR. |
See other products for " CRP "
MO-AB-25101H | Mouse Anti-Rat CRP Antibody (MO-AB-25101H) |
CBMOAB-71755FYA | Mouse Anti-Zebrafish crp Antibody (CBMOAB-71755FYA) |
CBMOAB-14173FYA | Mouse Anti-D. melanogaster Crp Antibody (CBMOAB-14173FYA) |
MOFY-0622-FY141 | Rabbit Anti-CRP Antibody (MOFY-0622-FY141) |
MO-DKB-00289W | Rabbit Anti-crp Antibody (MO-DKB-00289W) |
MO-AB-29903W | Mouse Anti-Dog CRP Antibody (MO-AB-29903W) |
MOFY-0722-FY306 | Rabbit Anti-CRP Antibody (MOFY-0722-FY306) |
MOFY-0622-FY24 | Mouse Anti-CRP Antibody (MOFY-0622-FY24) |
MO-AB-11079Y | Mouse Anti-O. mykiss Crp Antibody (MO-AB-11079Y) |
CBMOAB-39917FYA | Mouse Anti-Rhesus CRP Antibody (CBMOAB-39917FYA) |
For Research Use Only | Not For Clinical Use.
Online Inquiry