AibGenesis™ Mouse Anti-E. coli sbcB Antibody (CBMOAB-2533YC)
Cat: CBMOAB-2533YC

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
| Size: | |
| Conjugate: | |
| Inquiry |
- Specifications
- Application Information
- Target
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | E. coli (Escherichia coli ) |
| Clone | MO2533YC |
| Specificity | This antibody binds to Escherichia coli K-12 sbcB. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | Degrades single-stranded DNA (ssDNA) in a highly processive manner (PubMed:23609540). Also functions as a DNA deoxyribophosphodiesterase that releases deoxyribose-phosphate moieties following the cleavage of DNA at an apurinic/apyrimidinic (AP) site by either an AP endonuclease or AP lyase (PubMed:1329027). (From uniprot, under CC BY 4.0) |
| Product Overview | Mouse Anti-E. coli sbcB Antibody is a mouse antibody against sbcB. It can be used for sbcB detection in Western Blot and Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | Exonuclease; Fragment; sbcB |
| UniProt ID | C0Z3X9 |
| Protein Refseq | The length of the protein is 89 amino acids long. The sequence is show below: MTDTDKQPTFLFHDYETFGTHPALDRPAQFAAIRTDSEFNVIGEPEVFYCKPADDYLPQPGAVLITGITPQEARAKGENEAAFAARIHS. |
For Research Use Only | Not For Clinical Use.
Online Inquiry