AibGenesis™ Mouse Anti-gnsA Antibody (CBMOAB-1066YC)


Cat: CBMOAB-1066YC

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-1066YC Monoclonal E. coli (Escherichia coli ), Zebrafish (Danio rerio) WB, ELISA MO1066YC 100 µg
CBMOAB-78246FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO78246FYA 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityE. coli (Escherichia coli ), Zebrafish (Danio rerio)
CloneMO1066YC
SpecificityThis antibody binds to Escherichia coli K-12 gnsA.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-E. coli gnsA Antibody is a mouse antibody against gnsA. It can be used for gnsA detection in Western Blot and Enzyme-Linked Immunosorbent Assay.
Alternative NamesProtein GnsA; gnsA; yccL; b4517 JW0976
UniProt IDP0AC92
Protein RefseqThe length of the protein is 57 amino acids long. The sequence is show below: MNIEELKKQAETEIADFIAQKIAELNKNTGKEVSEIRFTAREKMTGLESYDVKIKIM.
For Research Use Only | Not For Clinical Use.
Online Inquiry