Mouse Anti-AhR Antibody (MO-AB-10610Y)
Cat: MO-AB-10610Y
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| MO-AB-10610Y | Monoclonal | O. mykiss (Oncorhynchus mykiss), Chicken (Gallus gallus), Chimpanzee (Pan troglodytes), E. coli (Escherichia coli ), Frog (Xenopus laevis), Guinea pig (Cavia porcellus), Marmoset, Pig (Sus scrofa) | WB, ELISA | MO10610Y | 100 µg | ||
| CBMOAB-0067YC | Monoclonal | E. coli (Escherichia coli ) | WB, ELISA | MO0067YC | 100 µg | ||
| MO-AB-21150W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO21150W | 100 µg | ||
| MO-AB-41201W | Monoclonal | Guinea pig (Cavia porcellus) | WB, ELISA | MO41201W | 100 µg | ||
| MO-AB-50616W | Monoclonal | Marmoset | WB, ELISA | MO50616W | 100 µg | ||
| MO-AB-23646R | Monoclonal | Pig (Sus scrofa) | WB, ELISA | MO23646R | 100 µg | ||
| MO-AB-01304H | Monoclonal | Frog (Xenopus laevis) | WB, ELISA | MO01304C | 100 µg | ||
| MO-AB-00091Y | Monoclonal | Chicken (Gallus gallus) | WB, ELISA | MO00091Y | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | O. mykiss (Oncorhynchus mykiss), Chicken (Gallus gallus), Chimpanzee (Pan troglodytes), E. coli (Escherichia coli ), Frog (Xenopus laevis), Guinea pig (Cavia porcellus), Marmoset, Pig (Sus scrofa) |
| Clone | MO10610Y |
| Specificity | This antibody binds to O. mykiss AhR. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | Ligand-activated transcriptional activator (PubMed:9022676). Binds to the XRE promoter region of genes it activates. Activates the expression of multiple phase I and II xenobiotic chemical metabolizing enzyme genes (such as the CYP1A1 gene). Mediates biochemical and toxic effects of halogenated aromatic hydrocarbons. Involved in cell-cycle regulation. Likely to play an important role in the development and maturation of many tissues. Regulates the circadian clock by inhibiting the basal and circadian expression of the core circadian component PER1. Inhibits PER1 by repressing the CLOCK-ARNTL/BMAL1 heterodimer mediated transcriptional activation of PER1. The heterodimer ARNT:AHR binds to core DNA sequence 5''-TGCGTG-3'' within the dioxin response element (DRE) of target gene promoters and activates their transcription (By similarity). |
| Product Overview | This product is a mouse antibody against AhR. It can be used for AhR detection in Western Blot and Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | Aryl hydrocarbon receptor; AhR |
| UniProt ID | Q7ZTG8 |
| Protein Refseq | The length of the protein is 56 amino acids long. The sequence is show below: LQPNNSSDITSNIVSYDPQHIPPENSSFLERSFVCRFRCLLDNSSGFLALNFNGRL. |
See other products for " ahr "
| MO-AB-42915W | Mouse Anti-ahr Antibody (MO-AB-42915W) |
| MO-AB-22826H | Mouse Anti-AHR Antibody (MO-AB-22826H) |
| MO-AB-07123Y | Mouse Anti-AHR Antibody (MO-AB-07123Y) |
For Research Use Only | Not For Clinical Use.
Online Inquiry