Mouse Anti-AHR Antibody (MO-AB-22826H)
Cat: MO-AB-22826H
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| MO-AB-22826H | Monoclonal | Mallard (Anas platyrhynchos), Chicken (Gallus gallus), Chimpanzee (Pan troglodytes), E. coli (Escherichia coli ), Frog (Xenopus laevis), Guinea pig (Cavia porcellus), Marmoset, Pig (Sus scrofa) | WB, ELISA | MO22826C | 100 µg | ||
| CBMOAB-0067YC | Monoclonal | E. coli (Escherichia coli ) | WB, ELISA | MO0067YC | 100 µg | ||
| MO-AB-21150W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO21150W | 100 µg | ||
| MO-AB-41201W | Monoclonal | Guinea pig (Cavia porcellus) | WB, ELISA | MO41201W | 100 µg | ||
| MO-AB-50616W | Monoclonal | Marmoset | WB, ELISA | MO50616W | 100 µg | ||
| MO-AB-23646R | Monoclonal | Pig (Sus scrofa) | WB, ELISA | MO23646R | 100 µg | ||
| MO-AB-01304H | Monoclonal | Frog (Xenopus laevis) | WB, ELISA | MO01304C | 100 µg | ||
| MO-AB-00091Y | Monoclonal | Chicken (Gallus gallus) | WB, ELISA | MO00091Y | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Mallard (Anas platyrhynchos), Chicken (Gallus gallus), Chimpanzee (Pan troglodytes), E. coli (Escherichia coli ), Frog (Xenopus laevis), Guinea pig (Cavia porcellus), Marmoset, Pig (Sus scrofa) |
| Clone | MO22826C |
| Specificity | This antibody binds to Mallard AHR. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
| Cellular Localization | Other locations; Nucleus |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | The protein encoded by this gene is a ligand-activated helix-loop-helix transcription factor involved in the regulation of biological responses to planar aromatic hydrocarbons. This receptor has been shown to regulate xenobiotic-metabolizing enzymes such as cytochrome P450. Before ligand binding, the encoded protein is sequestered in the cytoplasm; upon ligand binding, this protein moves to the nucleus and stimulates transcription of target genes. |
| Product Overview | This product is a mouse antibody against AHR. It can be used for AHR detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | Aryl hydrocarbon receptor; AHR |
| UniProt ID | Q9PTI8 |
| Protein Refseq | The length of the protein is 304 amino acids long. The sequence is show below: DRLNAELDRLASLLPFPQDVIAKLDKLSVLRLSVSYLRAKSFFDVALKSSNSTRPERNGIQENCRTAKLGEGMQILEGELLLQALNGFVLVVTADALVFYVSSTIQDYLGFQQSDIIHQSVFELIHTEDRPEFQRQLHWALNPSQSADSGPSVQGDNGFSQPATYYNPDQLPPENSSFMERNFICRLRCLLDNSSGFLAMNFQGRLKFLHGQNKKGKDGTTLSPQLALFAVATPLQPPSILEIRTKNFIFRTKHKLDFTPTGCDAKGKIVLGYTEAELCMRGTGYQFVHAADMLYCAENHVRMM. |
See other products for " AhR "
| MO-AB-10610Y | Mouse Anti-AhR Antibody (MO-AB-10610Y) |
| MO-AB-42915W | Mouse Anti-ahr Antibody (MO-AB-42915W) |
| MO-AB-07123Y | Mouse Anti-AHR Antibody (MO-AB-07123Y) |
For Research Use Only | Not For Clinical Use.
Online Inquiry