Mouse Anti-AHR Antibody (MO-AB-22826H)


Cat: MO-AB-22826H
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-22826H Monoclonal Mallard (Anas platyrhynchos), Chicken (Gallus gallus), Chimpanzee (Pan troglodytes), E. coli (Escherichia coli ), Frog (Xenopus laevis), Guinea pig (Cavia porcellus), Marmoset, Pig (Sus scrofa) WB, ELISA MO22826C 100 µg
CBMOAB-0067YC Monoclonal E. coli (Escherichia coli ) WB, ELISA MO0067YC 100 µg
MO-AB-21150W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO21150W 100 µg
MO-AB-41201W Monoclonal Guinea pig (Cavia porcellus) WB, ELISA MO41201W 100 µg
MO-AB-50616W Monoclonal Marmoset WB, ELISA MO50616W 100 µg
MO-AB-23646R Monoclonal Pig (Sus scrofa) WB, ELISA MO23646R 100 µg
MO-AB-01304H Monoclonal Frog (Xenopus laevis) WB, ELISA MO01304C 100 µg
MO-AB-00091Y Monoclonal Chicken (Gallus gallus) WB, ELISA MO00091Y 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityMallard (Anas platyrhynchos), Chicken (Gallus gallus), Chimpanzee (Pan troglodytes), E. coli (Escherichia coli ), Frog (Xenopus laevis), Guinea pig (Cavia porcellus), Marmoset, Pig (Sus scrofa)
CloneMO22826C
SpecificityThis antibody binds to Mallard AHR.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationOther locations; Nucleus

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein encoded by this gene is a ligand-activated helix-loop-helix transcription factor involved in the regulation of biological responses to planar aromatic hydrocarbons. This receptor has been shown to regulate xenobiotic-metabolizing enzymes such as cytochrome P450. Before ligand binding, the encoded protein is sequestered in the cytoplasm; upon ligand binding, this protein moves to the nucleus and stimulates transcription of target genes.
Product OverviewThis product is a mouse antibody against AHR. It can be used for AHR detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesAryl hydrocarbon receptor; AHR
UniProt IDQ9PTI8
Protein RefseqThe length of the protein is 304 amino acids long.
The sequence is show below: DRLNAELDRLASLLPFPQDVIAKLDKLSVLRLSVSYLRAKSFFDVALKSSNSTRPERNGIQENCRTAKLGEGMQILEGELLLQALNGFVLVVTADALVFYVSSTIQDYLGFQQSDIIHQSVFELIHTEDRPEFQRQLHWALNPSQSADSGPSVQGDNGFSQPATYYNPDQLPPENSSFMERNFICRLRCLLDNSSGFLAMNFQGRLKFLHGQNKKGKDGTTLSPQLALFAVATPLQPPSILEIRTKNFIFRTKHKLDFTPTGCDAKGKIVLGYTEAELCMRGTGYQFVHAADMLYCAENHVRMM.
For Research Use Only | Not For Clinical Use.
Online Inquiry