Mouse Anti-AK2 Antibody (CBMOAB-1975FYC)
Cat: CBMOAB-1975FYC
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| CBMOAB-1975FYC | Monoclonal | A. thaliana (Arabidopsis thaliana), Cat (Felis catus), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Elephant (Loxodonta africana), Ferret (Mustela Putorius Furo), Gorilla, Human (Homo sapiens), Mouse (Mus musculus), Rat (Rattus norvegicus), Zebrafish (Danio rerio), Human, Mouse, Zebrafish, Marmoset, O. mykiss (Oncorhynchus mykiss), Rabbit (Oryctolagus cuniculus), Sheep (Ovis aries) | WB, ELISA | MO1975FC | 100 µg | ||
| CBMOAB-65343FYA | Monoclonal | Zebrafish (Danio rerio) | WB, ELISA | MO65343FYA | 100 µg | ||
| MO-AB-08025W | Monoclonal | Cat (Felis catus) | WB, ELISA | MO08025W | 100 µg | ||
| MO-AB-13096W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO13096W | 100 µg | ||
| MO-AB-28903W | Monoclonal | Dog (Canis lupus familiaris) | WB, ELISA | MO28903W | 100 µg | ||
| MO-AB-34354W | Monoclonal | Ferret (Mustela Putorius Furo) | WB, ELISA | MO34354W | 100 µg | ||
| MO-AB-38436W | Monoclonal | Gorilla | WB, ELISA | MO38436W | 100 µg | ||
| MO-AB-50637W | Monoclonal | Marmoset | WB, ELISA | MO50637W | 100 µg | ||
| MO-AB-07174R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO07174R | 100 µg | ||
| MO-AB-24013H | Monoclonal | Rat (Rattus norvegicus) | WB, ELISA | MO24013C | 100 µg | ||
| MO-AB-00028L | Monoclonal | Elephant (Loxodonta africana) | WB, ELISA | MO00028L | 100 µg | ||
| MO-AB-07131Y | Monoclonal | Rabbit (Oryctolagus cuniculus) | WB, ELISA | MO07131Y | 100 µg | ||
| MO-AB-10613Y | Monoclonal | O. mykiss (Oncorhynchus mykiss) | WB, ELISA | MO10613Y | 100 µg | ||
| MO-AB-14148Y | Monoclonal | Sheep (Ovis aries) | WB, ELISA | MO14148Y | 100 µg | ||
| MO-DKB-00276W | Polyclonal | Human (Homo sapiens), Mouse (Mus musculus), Rat (Rattus norvegicus), Zebrafish (Danio rerio) | ELISA, WB, IHC, IF | 100 µg | |||
| MOFY-1222-FY6 | Polyclonal | Human, Mouse, Zebrafish | FC, IHC-P, WB | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | A. thaliana (Arabidopsis thaliana), Cat (Felis catus), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Elephant (Loxodonta africana), Ferret (Mustela Putorius Furo), Gorilla, Human (Homo sapiens), Mouse (Mus musculus), Rat (Rattus norvegicus), Zebrafish (Danio rerio), Human, Mouse, Zebrafish, Marmoset, O. mykiss (Oncorhynchus mykiss), Rabbit (Oryctolagus cuniculus), Sheep (Ovis aries) |
| Clone | MO1975FC |
| Specificity | This antibody binds to Arabidopsis AK2. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
| Cellular Localization | Chloroplast; Other locations |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | Adenylate kinases are involved in regulating the adenine nucleotide composition within a cell by catalyzing the reversible transfer of phosphate groups among adenine nucleotides. Three isozymes of adenylate kinase, namely 1, 2, and 3, have been identified in vertebrates; this gene encodes isozyme 2. Expression of these isozymes is tissue-specific and developmentally regulated. Isozyme 2 is localized in the mitochondrial intermembrane space and may play a role in apoptosis. Mutations in this gene are the cause of reticular dysgenesis. Alternate splicing results in multiple transcript variants. Pseudogenes of this gene are found on chromosomes 1 and 2. |
| Product Overview | Mouse Anti-Arabidopsis AK2 Antibody is a mouse antibody against AK2. It can be used for AK2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | Adenylate Kinase 2; Adenylate Monophosphate Kinase; ATP-AMP Transphosphorylase 2; ATP:AMP Phosphotransferase; EC 2.7.4.3; ADK2 |
| UniProt ID | O23653 |
| Protein Refseq | The length of the protein is 544 amino acids long. The sequence is show below: MASLQLYGVKTPGLALSSKRLEFASKGACFSVTLPSSSAVFRDVEHSCRNIGLRVSCEALRVDLLQRKEPETCDSSGTGKELTCVMKFGGSSVESAERMKEVANLILSFPDERPVIVLSAMGKTTNKLLKAGEKAVTCGVTNVESIEELSFIKELHLRTAHELGVETTVIEKHLEGLHQLLKGISMMKELTLRTRDYLVSFGECMSTRLFSAYLNKIGHKARQYDAFEIGFITTDDFTNADILEATYPAVSKTLVGDWSKENAVPVVTGYLGKGWRSCAITTLGRGGSDLTATTIGKALGLREIQVWKDVDGVLTCDPNIYPGAQSVPYLTFDEAAELAYFGAQVLHPLSMRPARDGDIPVRVKNSYNPTAPGTVITRSRDMSKAVLTSIVLKRNVTMLDIASTRMLGQYGFLAKVFTTFEDLGISVDVVATSEVSISLTLDPAKLWGRELIQRVNELDNLVEELEKIAVVKLLQRRSIISLIGNVQKSSLILEKVFQVFRSNGVNVQMISQGASKVNISLIVNDEEAEQCVRALHSAFFETDP. |
See other products for " AK2 "
| MO-AB-43616W | Mouse Anti-AK2 Antibody (MO-AB-43616W) |
| MO-DKB-01188W | Rabbit Anti-AK2 Antibody (MO-DKB-01188W) |
For Research Use Only | Not For Clinical Use.
Online Inquiry