Mouse Anti-AK2 Antibody (MO-AB-43616W)


Cat: MO-AB-43616W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-43616W Monoclonal Horse (Equus caballus), Cat (Felis catus), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Elephant (Loxodonta africana), Ferret (Mustela Putorius Furo), Gorilla, Human (Homo sapiens), Mouse (Mus musculus), Rat (Rattus norvegicus), Zebrafish (Danio rerio), Human, Mouse, Zebrafish, Marmoset, O. mykiss (Oncorhynchus mykiss), Rabbit (Oryctolagus cuniculus), Sheep (Ovis aries) WB, ELISA MO43616W 100 µg
CBMOAB-65343FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO65343FYA 100 µg
MO-AB-08025W Monoclonal Cat (Felis catus) WB, ELISA MO08025W 100 µg
MO-AB-13096W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO13096W 100 µg
MO-AB-28903W Monoclonal Dog (Canis lupus familiaris) WB, ELISA MO28903W 100 µg
MO-AB-34354W Monoclonal Ferret (Mustela Putorius Furo) WB, ELISA MO34354W 100 µg
MO-AB-38436W Monoclonal Gorilla WB, ELISA MO38436W 100 µg
MO-AB-50637W Monoclonal Marmoset WB, ELISA MO50637W 100 µg
MO-AB-07174R Monoclonal Cattle (Bos taurus) WB, ELISA MO07174R 100 µg
MO-AB-24013H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO24013C 100 µg
MO-AB-00028L Monoclonal Elephant (Loxodonta africana) WB, ELISA MO00028L 100 µg
MO-AB-07131Y Monoclonal Rabbit (Oryctolagus cuniculus) WB, ELISA MO07131Y 100 µg
MO-AB-10613Y Monoclonal O. mykiss (Oncorhynchus mykiss) WB, ELISA MO10613Y 100 µg
MO-AB-14148Y Monoclonal Sheep (Ovis aries) WB, ELISA MO14148Y 100 µg
MO-DKB-00276W Polyclonal Human (Homo sapiens), Mouse (Mus musculus), Rat (Rattus norvegicus), Zebrafish (Danio rerio) ELISA, WB, IHC, IF 100 µg
MOFY-1222-FY6 Polyclonal Human, Mouse, Zebrafish FC, IHC-P, WB 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityHorse (Equus caballus), Cat (Felis catus), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Elephant (Loxodonta africana), Ferret (Mustela Putorius Furo), Gorilla, Human (Homo sapiens), Mouse (Mus musculus), Rat (Rattus norvegicus), Zebrafish (Danio rerio), Human, Mouse, Zebrafish, Marmoset, O. mykiss (Oncorhynchus mykiss), Rabbit (Oryctolagus cuniculus), Sheep (Ovis aries)
CloneMO43616W
SpecificityThis antibody binds to Horse AK2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationMitochondrion; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionAdenylate kinases are involved in regulating the adenine nucleotide composition within a cell by catalyzing the reversible transfer of phosphate groups among adenine nucleotides. Three isozymes of adenylate kinase, namely 1, 2, and 3, have been identified in vertebrates; this gene encodes isozyme 2. Expression of these isozymes is tissue-specific and developmentally regulated. Isozyme 2 is localized in the mitochondrial intermembrane space and may play a role in apoptosis. Mutations in this gene are the cause of reticular dysgenesis. Alternate splicing results in multiple transcript variants. Pseudogenes of this gene are found on chromosomes 1 and 2. (From NCBI)
Product OverviewMouse Anti-Horse AK2 Antibody is a mouse antibody against AK2. It can be used for AK2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesAdenylate kinase 2, mitochondrial; AK 2; EC 2.7.4.3; ATP-AMP transphosphorylase 2; ATP:AMP phosphotransferase; Adenylate monophosphate kinase; AK2
UniProt IDF6XJN4
Protein RefseqThe length of the protein is234 amino acids long.
The sequence is show below: MAPNAPAAEEARKSPQGIRAVLLGPPGAGKGTQAPKLAENFCVCHLATGDMLRAMVASGSELGKKLKATMDAGKLVSDEMVVELIEKNLETPPCKNGFLLDGFPRTVRQAEMLDDLMEKRKEKLDSVIEFSVPDSLLIRRITGRLIHPLSGRSYHEEFNPPKEPMKDDITGEPLIRRSDDNEKALKVRLEAYHTQTTPLVEYYRKRGIHSAIDASQTPDVVFASILAAFSKATS.
See other products for " AK2 "
For Research Use Only | Not For Clinical Use.
Online Inquiry