Mouse Anti-Arabidopsis AGO2 Antibody (CBMOAB-1842FYC)


Cat: CBMOAB-1842FYC
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityA. thaliana (Arabidopsis thaliana)
CloneMO1842FC
SpecificityThis antibody binds to Arabidopsis AGO2.
FormatLyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus; Cytosol

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a member of the Argonaute family of proteins which play a role in RNA interference. The encoded protein is highly basic, and contains a PAZ domain and a PIWI domain. It may interact with dicer1 and play a role in short-interfering-RNA-mediated gene silencing. Multiple transcript variants encoding different isoforms have been found for this gene.
Product OverviewMouse Anti-Arabidopsis AGO2 (clone MO1842FC) Antibody (CBMOAB-1842FYC) is a mouse antibody against AGO2. It can be used for AGO2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesArgonaute 2, RISC Catalytic Component; Argonaute RISC Catalytic Component 2; Cancer Susceptibility Candidate 7 (Non-Protein Coding); Eukaryotic Translation Initiation Factor 2C, 2; PAZ Piwi Domain Protein; Protein Slicer; EIF2C2; PPD; Eukaryotic Translation Initiation Factor 2C 2; Long Intergenic Non-Protein Coding RNA 980; Cancer Susceptibility Candidate 7; Protein Argonaute-2
UniProt IDQ9SHF3
Protein RefseqThe length of the protein is 1014 amino acids long. The sequence is show below: MERGGYRGGRGDGRGRGGRGYGGGGGGGEQGRDRGYGGGEQGRGRGSERGGGNRGQGRGEQQDFRSQSQRGPPPGHGGRGTTQFQQPRPQVAPQPSQAPASYAGSVGGVAGRGAWGRKPQVPSDSASPSTSTTVVSEPVRVAEVMNLKPSVQVATSDRKEPMKRPDRGGVVAVRRVNLYVNHYKVNFNPESVIRHYDVEIKGEIPTKKVSRFELAMVRDKVFTDNPDEFPLAMTAYDGQKNIFSAVELPTGSYKVEYPKTEEMRGRSYTFTIKQVNVLKLGDLKEYMTGRSSFNPRDVLQGMDVVMKEHPSKCMITVGKSFFTRETEPDEDFRFGVIAAKGYRHTLKPTAQGLSLCLDYSVLAFRKAMSVIEYLKLYFNWSDMRQFRRRDVEEELIGLKVTVNHRKNKQKLTIVGLSMQNTKDIKFDLIDQEGNEPPRKTSIVEYFRIKYGRHIVHKDIPCLDLGKNGRQNFVPMEFCDLVEGQIYPKDNLDKDSALWLKKLSLVNPQQRQRNIDKMIKARNGPSGGEIIGNFGLKVDTNMTPVEGRVLKAPSLKLAERGRVVREEPNPRQNNQWNLMKKGVTRGSIVKHWAVLDFTASERFNKMPNDFVDNLIDRCWRLGMQMEAPIVYKTSRMETLSNGNAIEELLRSVIDEASRKHGGARPTLVLCAMSRKDDGYKTLKWIAETKLGLVTQCFLTGPATKGGDQYRANLALKMNAKVGGSNVELMDTFSFFKKEDEVMFIGADVNHPAARDKMSPSIVAVVGTLNWPEANRYAARVIAQPHRKEEIQGFGDACLELVKAHVQATGKRPNKIVIFRDGVSDAQFDMVLNVELLDVKLTFEKNGYNPKITVIVAQKRHQTRFFPATNNDGSDKGNVPSGTVVDTKVIHPYEYDFYLCSHHGGIGTSKPTHYYTLWDELGFTSDQVQKLIFEMCFTFTRCTKPVSLVPPVYYADMVAFRGRMYHEASSREKNFKQPRGASTSAASLASSLSSLTIEDKAIFKLHAELENVMFFV.
For Research Use Only | Not For Clinical Use.

Online Inquiry