Mouse Anti-Arabidopsis PSAN Antibody (MO-AB-00838H)


Cat: MO-AB-00838H
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityArabidopsis (Arabidopsis lyrata)
CloneMO00838C
SpecificityThis antibody binds to Arabidopsis PSAN.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationChloroplast; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionPSA is a chymotrypsin-like serine protease (family of kallikreins) produced by prostate epithelial cells and is abundant in semen. PSA can be detected in the serum of prostate cancer patients. It is primarily complexed with the liver-derived serine protease inhibitor alpha-1-antichymotrypsin (ACT). A higher proportion of serum PSA complexed with ACT in prostate cancer compared with benign prostatic hyperplasia. PSA is used to confirm the origin of prostate acinar cells in primary and metastatic cancers and to exclude non-prostate cancer analogs.
Product OverviewThis product is a mouse antibody against PSAN. It can be used for PSAN detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesPhotosystem I reaction center subunit psi-N; PSAN
UniProt IDD7MQK4
Protein RefseqThe length of the protein is 171 amino acids long.
The sequence is show below: MAAMNSSVLTCSYAIAGSGSVELNQKVGLVNSSVGFGQKKQMIMPVIKAQRVVGDDVDGSNGRRSAMVFLAATLFSTAAVSASANAGVIDEYLERSKANKELNDKKRLATSGANFARAFTVQFGSCKFPENFTGCQDLAKQKKVPFISEDLALECEGKDKYQCGSNVFWKW.
For Research Use Only | Not For Clinical Use.
Online Inquiry