Mouse Anti-Grape PsaN Antibody (MO-AB-39430W)
Cat: MO-AB-39430W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
| Size: | |
| Conjugate: | |
| Inquiry |
- Product Details
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Grape (Vitis vinifera) |
| Clone | MO39430W |
| Specificity | This antibody binds to Grape PsaN. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | PSA is a chymotrypsin-like serine protease (family of kallikreins) produced by prostate epithelial cells and is abundant in semen. PSA can be detected in the serum of prostate cancer patients. It is primarily complexed with the liver-derived serine protease inhibitor alpha-1-antichymotrypsin (ACT). A higher proportion of serum PSA complexed with ACT in prostate cancer compared with benign prostatic hyperplasia. PSA is used to confirm the origin of prostate acinar cells in primary and metastatic cancers and to exclude non-prostate cancer analogs. |
| Product Overview | Mouse Anti-Grape PsaN Antibody is a mouse antibody against PsaN. It can be used for PsaN detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | Putative photosystem I reaction center subunit N; PsaN |
| UniProt ID | Q6XGX6 |
| Protein Refseq | The length of the protein is85 amino acids long. The sequence is show below: LGFDDYLEKSKANKELNDKKRLATSGANFARAYTVQFGTCKFPENFTGCQDLAKKKKVPFLSEDLELECEGRDKYKCGSNVFWKW. |
See other products for " PSAN "
| MO-AB-00838H | Mouse Anti-Arabidopsis PSAN Antibody (MO-AB-00838H) |
| MO-DKB-02989W | Rabbit Anti-PsaN Antibody (MO-DKB-02989W) |
| CBMOAB-39398FYC | Mouse Anti-Arabidopsis PSAN Antibody (CBMOAB-39398FYC) |
| MO-DKB-01777W | Rabbit Anti-PsaN Antibody (MO-DKB-01777W) |
| MOFAB-297W | Rabbit Anti-PsaN Antibody (MOFAB-297W) |
| MO-DKB-0414RA | Rabbit Anti-PsaN Antibody (MO-DKB-0414RA) |
For Research Use Only | Not For Clinical Use.
Online Inquiry