Cat: MO-AB-39430W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product Details
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Grape (Vitis vinifera) |
Clone | MO39430W |
Specificity | This antibody binds to Grape PsaN. |
Format | Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Product Overview | Mouse Anti-Grape PsaN (clone MO39430W) Antibody (MO-AB-39430W) is a mouse antibody against PsaN. It can be used for PsaN detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | Putative photosystem I reaction center subunit N; PsaN |
UniProt ID | Q6XGX6 |
Protein Refseq | The length of the protein is85 amino acids long. The sequence is show below: LGFDDYLEKSKANKELNDKKRLATSGANFARAYTVQFGTCKFPENFTGCQDLAKKKKVPFLSEDLELECEGRDKYKCGSNVFWKW. |
See other products for " PsaN "
MO-DKB-02989W | Rabbit Anti-PsaN Antibody (MO-DKB-02989W) |
MO-DKB-0414RA | Rabbit Anti-PsaN Antibody (MO-DKB-0414RA) |
MOFAB-297W | Rabbit Anti-PsaN Antibody (MOFAB-297W) |
CBMOAB-39399FYC | Mouse Anti-Arabidopsis PSAN Antibody (CBMOAB-39399FYC) |
MO-DKB-01777W | Rabbit Anti-PsaN Antibody (MO-DKB-01777W) |
MO-AB-00838H | Mouse Anti-Arabidopsis PSAN Antibody (MO-AB-00838H) |
CBMOAB-39398FYC | Mouse Anti-Arabidopsis PSAN Antibody (CBMOAB-39398FYC) |
For Research Use Only | Not For Clinical Use.