Mouse Anti-Barrel medic FUT2 Antibody (MO-AB-00208W)


Cat: MO-AB-00208W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityBarrel medic (Medicago truncatula)
CloneMO00208W
SpecificityThis antibody binds to Barrel medic FUT2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationGolgi apparatus; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein encoded by this gene is a Golgi stack membrane protein that is involved in the creation of a precursor of the H antigen, which is required for the final step in the soluble A and B antigen synthesis pathway. This gene is one of two encoding the galactoside 2-L-fucosyltransferase enzyme. Two transcript variants encoding the same protein have been found for this gene.
Product OverviewMouse Anti-Barrel medic FUT2 Antibody is a mouse antibody against FUT2. It can be used for FUT2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCore alpha 1,3-fucosyltransferase; FUT2
UniProt IDQ6Q5Y3
Protein RefseqThe length of the protein is 504 amino acids long.
The sequence is show below: MGLVSRTTTTTTQEGLPVSVSTTVPKKKWSNLMPLFVALVVIAEIAFLGRLDMAKNAATVADLFYRSRAVVEGDDFGLEMVGGDKNLELESESCEEWLGREDAVPYSRNFTKEPVFVSGAEQEWKSCSVGCKFRFNGDRKPEAAFSLPQQAGTASILKSMESAQYYAENNIAMARRRGYHIVMTTSLSSDVPVGYFSWAEYDIMAPIKPKTEKALAAAFISNCGARNFRLQALEALEKTNISIDSYGSCHRNRDGRVDKLEALTRYKFSLAFENSNEEDYVTEKFFQSLVAGTIPVVVGPPNIQDFAPSPGSFLYIKELEDVESVAKSMRYLAENPEAYNQSLRWKYEGPSDSFKALVDMAAVHSSCRLCIHLASKSREKEEKSPDFKRRPCKCTRGSETVYHIYVRERGTFEMESIYLRSSNLTLESFKTAVLTKFTSLNHVPVWKPERPEILKGGDELKVYKIYPAGLTQRQALYTFKFNGDVDFRSHLESNPCAKFEVVFV.
See other products for " FUT2 "
MO-AB-12761RMouse Anti-Cattle FUT2 Antibody (MO-AB-12761R)
MO-AB-55726WMouse Anti-Marmoset FUT2 Antibody (MO-AB-55726W)
MO-AB-08144YMouse Anti-Rabbit FUT2 Antibody (MO-AB-08144Y)
CBMOAB-33591FYCMouse Anti-Arabidopsis FUT2 Antibody (CBMOAB-33591FYC)
CBMOAB-43224FYAMouse Anti-Rhesus FUT2 Antibody (CBMOAB-43224FYA)
CBMOAB-04212HCBMouse Anti-C. elegans FUT2 Antibody (CBMOAB-04212HCB)
For Research Use Only | Not For Clinical Use.
Online Inquiry