Mouse Anti-Marmoset FUT2 Antibody (MO-AB-55726W)


Cat: MO-AB-55726W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityMarmoset
CloneMO55726W
SpecificityThis antibody binds to Marmoset FUT2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationOther locations; Golgi apparatus

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein encoded by this gene is a Golgi stack membrane protein that is involved in the creation of a precursor of the H antigen, which is required for the final step in the soluble A and B antigen synthesis pathway. This gene is one of two encoding the galactoside 2-L-fucosyltransferase enzyme. Two transcript variants encoding the same protein have been found for this gene.
Product OverviewMouse Anti-Marmoset FUT2 Antibody is a mouse antibody against FUT2. It can be used for FUT2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesGalactoside 2-alpha-L-fucosyltransferase 2; FUT2
UniProt IDF7HA38
Protein RefseqThe length of the protein is 343 amino acids long.
The sequence is show below: MLISQVTFSFPMAHFVLFVFTASTVFHVQQRLAKIQAMWDLEEQVPAQASMSEGLGPSQPRGMWTINAIGRLGNQMGEYATLYALAKLNGRPAFIPAQMHSTLAPIFKITLPVLHSSTASSIRWRNYHLNDWMEEAYRHIPWEYVRLTGYPCSWTFYHHLRQEILQEFTLHDHVREEAQGFLRGLRLNGSRPGTFVGVHVRRGDYVSVMPRVWKGVVADRHYLEQALDWFRTHHSNPVFVVTSNGMPWCRQNIDTSRGDVVFAGDGIEGSPGKDFALLTQCNHTIMTIGTFGIWAAYLTGGDTIYLANYTLPDSPFLKVFKPEAAFLPEWMGIAADLSPLLKH.
For Research Use Only | Not For Clinical Use.
Online Inquiry