Mouse Anti-Cattle FUT2 Antibody (MO-AB-12761R)


Cat: MO-AB-12761R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCattle (Bos taurus)
CloneMO12761R
SpecificityThis antibody binds to Cattle FUT2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationGolgi apparatus; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionMediates the transfer of fucose to the terminal galactose on glycan chains of cell surface glycoproteins and glycolipids (PubMed:7721792). The resulting epitope plays a role in cell-cell interaction including host-microbe interaction (By similarity). Mediates interaction with intestinal microbiota influencing its composition (By similarity). Creates a soluble precursor oligosaccharide FuC-alpha ((1,2)Galbeta-) called the H antigen, which is an essential substrate for the final step in the membrane-associated blood group antigen synthesis pathway (PubMed:7721792).
Product OverviewMouse Anti-Cattle FUT2 Antibody is a mouse antibody against FUT2. It can be used for FUT2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesGalactoside 2-alpha-L-fucosyltransferase 2; EC 2.4.1.69; Alpha(1,2)FT 2; Fucosyltransferase 2; GDP-L-fucose:beta-D-galactoside 2-alpha-L-fucosyltransferase 2; FUT2
UniProt IDQ28113
Protein RefseqThe length of the protein is 344 amino acids long.
The sequence is show below: MFSTQTFFFFPTAPFILFVFTASTIFHLHQRLEKMQPTWELEALEPATMETPSRPQPRPQLKGMWTINAIGRLGNQMGEYATLYALAKMNGRAAFIPPQMHSTLAPIFRITLPVLHDATARSVPWQNYHLNDWMEEQYRHIPGEYVRLTGYPCSWTFYHHLRAEILQEFTLHAHVREEAQNFLRGLRVNGSRPSTYVGVHVRRGDYVHVMPNVWKGVVADRRYLEQALDWFRARYSAPIFVVSSNGMAWCRENIN.
See other products for " FUT2 "
MO-AB-08144YMouse Anti-Rabbit FUT2 Antibody (MO-AB-08144Y)
CBMOAB-33591FYCMouse Anti-Arabidopsis FUT2 Antibody (CBMOAB-33591FYC)
MO-AB-55726WMouse Anti-Marmoset FUT2 Antibody (MO-AB-55726W)
MO-AB-00208WMouse Anti-Barrel medic FUT2 Antibody (MO-AB-00208W)
CBMOAB-43224FYAMouse Anti-Rhesus FUT2 Antibody (CBMOAB-43224FYA)
CBMOAB-04212HCBMouse Anti-C. elegans FUT2 Antibody (CBMOAB-04212HCB)
For Research Use Only | Not For Clinical Use.
Online Inquiry